hoxa5

Homeobox protein Hox-A5

281 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family.

31.124 kDa

MSSYFVNSFCGRYPNGADFQLHNYGDHSTANDQYRDSTAMHSSRYGYGYNGMDLTVGRAGTGHFVGNERTQGYSPSHSAATTPSVEPVRYTQSANSTGTSSLSPPPDPLPCSSVASSSPVTETQSQHRAVKNSITTPCSTPCSSSNGGTLLLNRDCVSKASPLEEEKPAGSAPTTPQNVSDSTQPQIYPWMRKLHINHDLAGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMNMAAAGGGGYRP

HOXA5

Homeobox protein Hox-A5

275 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family.

30.214 kDa

MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQYRDSATMHSSRYGYGYNGMDLSISRPASNHFNASERSRSYSAAAATTAAAAGPEAGADTRYNQPATSSPSPDPLPCSAVVSPSAGDNHHGIKNSIASPTTSSNSSSSSSHISRDGVGTSPGTEDDTPASSDPPSSQNGQSTAQQQPQIYPWMRKLHISHDSMGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGGYRP

HOXA5

Homeobox protein Hox-A5

270 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5'-CYYNATTA[TG]Y-3'.

Belongs to the Antp homeobox family.

29.345 kDa

MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP

HOXA5

Homeobox protein Hox-A5

270 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5'-CYYNATTA[TG]Y-3' (By similarity).

Belongs to the Antp homeobox family.

29.223 kDa

MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAAGASAAPAEPRYSQPATSTHSPPPDPLPCSAVAPSPGGDSHHGGKNSLGNSSGASANAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP

HOXA5

Homeobox protein Hox-A5

270 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5'-CYYNATTA[TG]Y-3' (By similarity).

Belongs to the Antp homeobox family.

29.297 kDa

MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAAGATTAPAEPRYSQPATSTHSPPPDPLPCSAVAPSPGSDSHHGGKNSLGNSSGASANAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP

Hoxa5

Homeobox protein Hox-A5

270 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5'-CYYNATTA[TG]Y-3'.

Belongs to the Antp homeobox family.

29.237 kDa

MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAAGASAAPAEPRYSQPATSTHSPPPDPLPCSAVAPSPGSDSHHGGKNSLGNSSGASANAGSTHISSREGVGTASAAEEDAPASSEQAGAQSEPSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP

HOXA5

Homeobox protein Hox-A5

270 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5'-CYYNATTA[TG]Y-3' (By similarity).

Belongs to the Antp homeobox family.

29.253 kDa

MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAAGASAAPAEPRYSQPATSTHSPPPDPLPCSAVAPSPGSDSHHGGKNSLGNSSGASANAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP

HOXA5

Homeobox protein Hox-A5

270 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5'-CYYNATTA[TG]Y-3' (By similarity).

Belongs to the Antp homeobox family.

29.742 kDa

MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQYRDSASMHSGRYGYGYNGMDLSVGRSASTHFGASERARTYPANSTSASTEPRYSQSAAASHSPPPDPLPCTAVAASPVSESHHGVKNSLGNSSSTSSNSSSSTHISRDGVGTSSGTEEDTPASSEQASAPSDQSTAQPSQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP

Hoxa5

Homeobox protein Hox-A5

233 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5'-CYYNATTA[TG]Y-3' (By similarity).

Belongs to the Antp homeobox family.

25.391 kDa

single

HNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGEXXRSYXAGASAAPAEPRYSQPATSTHSPPPDPLPCSAVAPLPGSDTHHGGKNSLGNSSGCSANCGSTHISSREGVGTASAAEEDAPASSEQAGAQSEPSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTCYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDK

HOXA5

Homeobox protein Hox-A5

148 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family.

16.758 kDa

single

VAVGSSSHISSRDGLGTSSGTEDDTPGAAGRREGKFTARSERTLGRAGGGPPQIYPWMRKLHISHDNIGGPRGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP

hoxa5

Homeobox protein Hox-A5

78 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family.

9.489 kDa

single

GRGRGQTYTRYQTLELEKEFHFNRYLTRRRRIEMAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGVGYHRP

HOXA5

Homeobox protein Hox-A5

49 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5'-CYYNATTA[TG]Y-3' (By similarity).

Belongs to the Antp homeobox family.

6.331 kDa

single

QTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDN