HOXA1

Homeobox protein Hox-A1

335 amino acids

Sequence-specific transcription factor (By similarity). Regulates multiple developmental processes including brainstem, inner and outer ear, abducens nerve and cardiovascular development and morphogenesis as well as cognition and behavior (PubMed:16155570). Also part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments (By similarity). Activates transcription in the presence of PBX1A and PKNOX1 (By similarity).

Belongs to the Antp homeobox family. Labial subfamily.

36.641 kDa

MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH

Hoxa1

Homeobox protein Hox-A1

333 amino acids

Sequence-specific transcription factor (By similarity). Regulates multiple developmental processes including brainstem, inner and outer ear, abducens nerve and cardiovascular development and morphogenesis as well as cognition and behavior (By similarity). Also part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments (By similarity). Activates transcription in the presence of PBX1A and PKNOX1 (By similarity).

Belongs to the Antp homeobox family. Labial subfamily.

36.124 kDa

MDNARLNSFLEYPILGSGDSGTCSARVYSSDHGITTFQSCAVSANSCGGDDRFLGGRGVQITSPHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGAQNFSAPYGPYGLNQEADVSGGYPPCAPAVYSGNLSSPMVQHHHHHQGYAGGTVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYVGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARSEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPMSPATPPGSDEKTEESSEKSSSSPSAPSPASSTSDTLTTSH

Hoxa1

Homeobox protein Hox-A1

331 amino acids

The homeoboxless ERA-1-399 protein could act as a competitive inhibitor of the ERA-1-993 protein by competing for interaction with regulatory protein(s) while being unable to bind to DNA.

Belongs to the Antp homeobox family. Labial subfamily.

36.037 kDa

MNSFLEYPILGSGDSGTCSARAYPSDHGITTFQSCAVSANSCGGDDRFLVGRGVQISSPHHHHHHHHHHHPQTATYQTSGNLGISYSHSSCGPSYGAQNFSAPYGPYGLNQEADVSGGYPPCAPAVYSGNLSTPMVQHHHHHQGYAGGTVGSPQYIHHSYGQEQQTLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYVGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPSAPSPASSTSDTLTTSH

HOXA1

Homeobox protein Hox-A1

326 amino acids

Sequence-specific transcription factor. Part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments.

Belongs to the Antp homeobox family. Labial subfamily.

35.419 kDa

MDNARMNSFLDYSIINGETGTCSSRSYHADQGITTYQSCAVSNNNCNADDRYIVSRSVQIGAPPPHHHHHQSNYTHPNNLGISYSAHPNCGAGYPAQSFNTGYSHHYSLNQETDGNGGYPQCAPAVYPGNIASAISPHHHSYGGMVGSGQYPHHPYGQEQQGLALAAGCHSLSPVHGSHQEACCSPSAETPPPAQTFDWMKVKRNPPKTGKAGEYGFAGQPNTVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWFQNRRMKQKKREKEGLTSASPATPGSEANTEDTSDKCNSTSSTPSPSSSTSETINTSG

hoxa1

Homeobox protein Hox-A1

240 amino acids

Sequence-specific transcription factor. Part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments.

Belongs to the Antp homeobox family. Labial subfamily.

26.585 kDa

single

AYAHSSCGSNYGMQNFSPGYSHFPIHQETEVSSGFPQSVYSGNIASSVVQHQQHQSYIEGSAHYIHHSYGPEQNLSVANYNNNVASLHISQREVCHSPSSETSPGPTQTFDWMKVKRNPPKTGKAGEYGYAGQPNTARTNFTTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWFQNRRMKQKKREKEGLLPISPSTSTGSDEKSEELSEKSNSSPCAPSPASSTSDHLSASG