hook3

Protein Hook homolog 3

719 amino acids

May function to promote vesicle trafficking and/or fusion. May participate in defining the architecture and localization of the Golgi complex. May act as adapter protein linking the dynein motor complex to various cargos.

Belongs to the hook family.

83.219 kDa

MQSLDRVDLCESLLTWIQTFHVDAPCKTVEDLTSGVAMAMVLQKIDPVYFDENWLNRIKTDVGDNWRLKISNLKKILKGILDYNHEILGHQVNDFTLPDVILIGEHSDASELGRMLQLILGCAVKCEQKQEYIQAIMMMEESVQHVVMTAIQELMSKETPVSIGTDAYAELDRQLKKANEELNDALSAKEEIAQRCHELDMQVAGLQEEKSSLLAENQILMERMNQSDSLEDPNSPAGRRHLQLQTQLEQLQEETFRLEASKDDYRIRCEELEKEITEFRQQNEDLITLADEAQSLKDEMDVLRHSSDKVAKLESQVDSYKKKLEDLGDLRRQVKLLEEKNTMYMQNTVSLEEELRKANAARSQLETYKRQVVELQNRLSEESKKADKLEFEYKRLKEKIDSLQKEKDRLRSERDSLKETIEELRCVQAQEGQLTSAGLMPLGNQEPTDSLAAEIVTPEIKEKLIRLQHENKMLKINQEGSDNEKISLLQSLLDDANMRKNELETENRLVNQRLIEMQSQVEELQKSLQEQGAKTEDSLLLKKKLEEHLEKLHEANNELQKKRAIIEDLEPRYNNSSMKIEELQDALRKKEEDMKQMEERYKKYLEKAKSVIRTLDPKQNQGTGPEIQALKNQLQERDKMFVSLEKEFEKTKTQRDQEEKLIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSSRRSYPGHVQPATASDVIA

HOOK3

Protein Hook homolog 3

718 amino acids

Probably serves as a target for the spiC protein from Salmonella typhimurium, which inactivates it, leading to a strong alteration in cellular trafficking (By similarity). Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). May regulate clearance of endocytosed receptors such as MSR1. Participates in defining the architecture and localization of the Golgi complex. Acts as an adapter protein linking the dynein motor complex to various cargos and converts dynein from a non-processive to a highly processive motor in the presence of dynactin. Facilitates the interaction between dynein and dynactin and activates dynein processivity (the ability to move along a microtubule for a long distance without falling off the track) (PubMed:25035494).

Belongs to the hook family.

83.126 kDa

MFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDPAYFDENWLNRIKTEVGDNWRLKISNLKKILKGILDYNHEILGQQINDFTLPDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVVMTAIQELMSKESPVSAGNDAYVDLDRQLKKTTEELNEALSAKEEIAQRCHELDMQVAALQEEKSSLLAENQVLMERLNQSDSIEDPNSPAGRRHLQLQTQLEQLQEETFRLEAAKDDYRIRCEELEKEISELRQQNDELTTLADEAQSLKDEIDVLRHSSDKVSKLEGQVESYKKKLEDLGDLRRQVKLLEEKNTMYMQNTVSLEEELRKANAARSQLETYKRQVVELQNRLSEESKKADKLDFEYKRLKEKVDSLQKEKDRLRTERDSLKETIEELRCVQAQEGQLTTQGLMPLGSQESSDSLAAEIVTPEIREKLIRLQHENKMLKLNQEGSDNEKIALLQSLLDDANLRKNELETENRLVNQRLLEVQSQVEELQKSLQDQGSKAEDSVLLKKKLEEHLEKLHEANNELQKKRAIIEDLEPRFNNSSLKIEELQEALRKKEEEMKQMEERYKKYLEKAKSVIRTLDPKQNQGAAPEIQALKNQLQERDRLFHSLEKEYEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSSRRSYPGHVQPATAR

Hook3

Protein Hook homolog 3

718 amino acids

Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). May regulate clearance of endocytosed receptors such as MSR1. Participates in defining the architecture and localization of the Golgi complex (By similarity). Serves as a target for the spiC protein from Salmonella typhimurium, which inactivates it, leading to a strong alteration in cellular trafficking (PubMed:12950921). Acts as an adapter protein linking the dynein motor complex to various cargos and converts dynein from a non-processive to a highly processive motor in the presence of dynactin. Facilitates the interaction between dynein and dynactin and activates dynein processivity (the ability to move along a microtubule for a long distance without falling off the track) (By similarity).

Belongs to the hook family.

83.218 kDa

MFNVESVERVELCESLLTWIQTFNVDAPCQTAEDLTNGVVMSQVLQKIDPVYFDDNWLNRIKTEVGDNWRLKISNLKKILKGILDYNHEILGQQINDFTLPDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVVMTAIQELMSKESPVSAGHDAYVDLDRQLKKTTEELNEALSAKEEIAQRCHELDMQVAALQEEKSSLLAENQILMERLNQSDSIEDPNSPAGRRHLQLQTQLEQLQEETFRLEAAKDDYRIRCEELEKEISELRQQNDELTTLADEAQSLKDEIDVLRHSSDKVSKLEGQVESYKKKLEDLGDLRRQVKLLEEKNTMYMQNTVSLEEELRKANAARGQLETYKRQVVELQNRLSDESKKADKLDFEYKRLKEKVDGLQKEKDRLRTERDSLKETIEELRCVQAQEGQLTTQGLMPLGSQESSDSLAAEIVTPEIREKLIRLQHENKMLKLNQEDSDNEKIALLQSLLDDANLRKNELETENRLVNQRLLEVQSQVEELQKSLQDQGSKAEDSVLLKKKLEEHLEKLHEANNELQKKRAIIEDLEPRFNNSSLRIEELQEALRKKEEEMKQMEERYKKYLEKAKSVIRTLDPKQNQGAAPEIQALKNQLQERDRLFHSLEKEYEKTKSQRDMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSTRRSYPGHVQPATAR

HOOK3

Protein Hook homolog 3

12 amino acids

Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). May regulate clearance of endocytosed receptors such as MSR1. Participates in defining the architecture and localization of the Golgi complex. Serves as a target for the spiC protein from Salmonella typhimurium, which inactivates it, leading to a strong alteration in cellular trafficking. Acts as an adapter protein linking the dynein motor complex to various cargos and converts dynein from a non-processive to a highly processive motor in the presence of dynactin. Facilitates the interaction between dynein and dynactin and activates dynein processivity (the ability to move along a microtubule for a long distance without falling off the track).

Belongs to the hook family.

1.417 kDa

single

VELQNRLSDESQ