HMLALPHA2

Mating-type protein ALPHA2

223 amino acids

Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion. Transcriptional corepressor that acts in conjunction with A1 to repress transcription of haploid-specific genes (By similarity).

Belongs to the TALE/M-ATYP homeobox family.

26.508 kDa

MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQEMFYSMLENNDDYNKIESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLKEKGKMREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFLKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNILN

HMLALPHA2

Silenced mating-type protein ALPHA2

210 amino acids

Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion. Silenced copy of ALPHA2 at HML.

Belongs to the TALE/M-ATYP homeobox family.

24.282 kDa

MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE