HEYL

Hairy/enhancer-of-split related with YRPW motif-like protein

328 amino acids

Downstream effector of Notch signaling which may be required for cardiovascular development. Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGTG-3'. Represses transcription by the cardiac transcriptional activators GATA4 and GATA6.

Belongs to the HEY family.

35.192 kDa

MKRPREPSGSDSESDGPIDVGREGELSQMARPLSTPSPSQMQARKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLEGPSSRADPVRIRLLSHLNSYAAEMEPSPTPPGPLAFPAWPWSFFHSCPGLSAPSNQLAILGRVPGPMLPNASSLAYPIPGLRAAPLRRAAGTILPARRNLLPSRGASSTRRARPLERPAAPLPAAPSGRATRGSHMAPLLRSPSPVSPGMVGSPAYMAVPAPRPSSPGLAGRPAGAMLCRSWVSEITEVGAF

HEYL

Hairy/enhancer-of-split related with YRPW motif-like protein

328 amino acids

Downstream effector of Notch signaling which may be required for cardiovascular development (By similarity). Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGTG-3' (By similarity). Represses transcription by the cardiac transcriptional activators GATA4 and GATA6.

Belongs to the HEY family.

35.087 kDa

MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGIIEKRRRDRINSSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLEGPSSRADPVRIRLLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFFHSCPGLPALSNQLAILGRVPSPVLPGVSSPAYPIPALRTAPLRRATGIILPARRNVLPSRGASSTRRARPLERPATPVPVAPSSRAARSSHIAPLLQSSSPTPPGPTGSAAYVAVPTPNSSSPGPAGRPAGAMLYHSWVSEITEIGAF

Heyl

Hairy/enhancer-of-split related with YRPW motif-like protein

326 amino acids

Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGTG-3' (By similarity). Downstream effector of Notch signaling required for cardiovascular development. Specifically required for the Notch-induced endocardial epithelial to mesenchymal transition, which is itself criticial for cardiac valve and septum development. Represses transcription by the cardiac transcriptional activators GATA4 and GATA6.

Belongs to the HEY family.

34.929 kDa

MKRPRAPSGSDGESDGPIDVGQENDLSQMARPLTTPSPSQMQARKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHASGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLEGPSSHADPVRIRLLSHLKSYAAEMEPSPTTTSALAFPVWPWSFLHSCPGLPSLNSQLAILGRVPGPVLPSISSPPYPISALRSAPVHRPAGTIPPTRRNLLPSRGVTSTQRAHLPERPAAPPPTALDARAARSIVPIPPCSPTTAPGAGKSDDNVSGSISSPCPSGPTGRPAGAVFYHSWVSEITEIGAF

heyl

Hairy/enhancer-of-split related with YRPW motif-like protein

310 amino acids

Transcriptional repressor which functions as a downstream effector of Notch signaling.

Belongs to the HEY family.

33.392 kDa

MKRPHDYSSPDSDTDELIDVGQEDSYCPVTGSMSPGSTSQILARKKRRGIIEKRRRDRINHSLSELRRLVPSAFEKQGSSKLEKAEILQMTVDHLKLLHAMGGKGYFDARALAVDYRTLGFRECVGEVVRYLSSLEGVESSDPIGARLVSHLSHCASELDPLLQSPAALPFPPWPWASFPQLQAASPPASSTPFPPNARRDLAPHGTATILGYPSPALRMGSLSTQGTILNPALTSVRQLPSVPGHLHRLQQHSPEGRTVPSSSSSSSNSSPPQISFRPFVPAGSPAGGRRALSSSSKSAQAWGTEIGAF