HES1

Protein HES1

434 amino acids

Plays a role in ergosterol synthesis.

Belongs to the OSBP family.

49.505 kDa

MSQHASSSSWTSFLKSISSFNGDLSSLSAPPFILSPTSLTEFSQYWAEHPALFLEPSLIDGENYKDHCPFDPNVESKEVAQMLAVVRWFISTLRSQYCSRSESMGSEKKPLNPFLGEVFVGKWKNDEHPEFGETVLLSEQVSHHPPMTAFSIFNEKNDVSVQGYNQIKTGFTKTLTLTVKPYGHVILKIKDETYLITTPPLHIEGILVASPFVELGGRSFIQSSNGMLCVIEFSGRGYFTGKKNSFKARIYRSPQEHSHKENALYLISGQWSGVSTIIKKDSQVSHQFYDSSETPTEHLLVKPIEEQHPLESRRAWKDVAEAIRQGNISMIKKTKEELENKQRALREQERVKGVEWQRRWFKQVDYMNENTSNDVEKASEDDAFRKLASKLQLSVKNVPSGTLIGGKDDKKDVSTALHWRFDKNLWMRENEITI

HES1

Transcription factor HES-1

290 amino acids

Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1 (By similarity).

31.072 kDa

MPADTGMEKPTASPIAGAPASASHTPDKPRSASEHRKSSKPIMEKRRRARINESLGQLKMLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMAAALSADPSVLGKYRAGFNECMNEVTRFLSTCEGVNADVRARLLGHLSACLGQIVAMNYLPPPPAGQPAHLAQPLHVQLPPTTTGAVPVPCKLEPTEALSPKVYGGFQLVPATDGQFAFLIPNPAFPPGSGPVIPLYANANVPVSTAWRSSERVHPPAGIPGAGLDIIWARVVPASQAGSPIAERREAVWRPW

Hes1

Transcription factor HES-1

282 amino acids

Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1 (By similarity). Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity. May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage (By similarity).

29.749 kDa

MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAHPALQAPPPPPPSGPAGPQHAPFAPPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTSDSMWRPWRN

Hes1

Transcription factor HES-1

281 amino acids

Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity. May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage (By similarity).

29.622 kDa

MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAHPALQAPPPPPPSGPGGPQHAPFAPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTADSMWRPWRN

HES1

Transcription factor HES-1

280 amino acids

Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity (By similarity). May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage (By similarity).

29.51 kDa

MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSPAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN

HES1

Transcription factor HES-1

280 amino acids

Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity (By similarity). May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage.

29.541 kDa

MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN

hes1

Transcription factor HES-1

267 amino acids

Transcriptional repressor of a subset of early mesodermal genes including myod1 and t/bra. Binds DNA on N-box motifs: 5'-CACNAG-3'. Acts as a negative regulator of myogenesis, mediating Notch signaling to repress expression of myod1 (By similarity).

28.736 kDa

MPADLMEKNSSSPVAATPASMSNTPDKPKTASEHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRVQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTDVRTRLLGHLANCMNQINAMNYPTQPQIPAAAAPHPAYGQPLVQLQGAAPQSSPAPIACKMGGPPVEAAKVYGGFQLVPAPDGQFAFLITNPAFPHNGSVIPVYTNSNVGTALPPSVSPSVMPSVTADSVWRPW