HAND2

Heart- and neural crest derivatives-expressed protein 2

217 amino acids

Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Is involved in the development of branchial arches, which give rise to unique structures in the head and neck. Binds DNA on E-box consensus sequence 5'-CANNTG-3' (By similarity).

23.666 kDa

MSLVGGFPHHPVVHHEGYPFAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ

Hand2

Heart- and neural crest derivatives-expressed protein 2

217 amino acids

Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Is involved in the development of branchial arches, which give rise to unique structures in the head and neck. Binds DNA on E-box consensus sequence 5'-CANNTG-3'.

23.666 kDa

MSLVGGFPHHPVVHHEGYPFAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ

Hand2

Heart- and neural crest derivatives-expressed protein 2

217 amino acids

Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Is involved in the development of branchial arches, which give rise to unique structures in the head and neck. Binds DNA on E-box consensus sequence 5'-CANNTG-3' (By similarity).

23.666 kDa

MSLVGGFPHHPVVHHEGYPFAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ

HAND2

Heart- and neural crest derivatives-expressed protein 2

216 amino acids

Essential for cardiac morphogenesis. Binds DNA on E-box consensus sequence 5'-CANNTG-3' (By similarity). Plays an important role in limb development, particularly in the establishment of anterior-posterior polarization of the limb bud.

24.407 kDa

MSLVGGFPHHPVVHHEGYPLRRRRCRRRRRHPLRPRGEPLLHGWLISSHPEMSPPDYSMALSYSPEYANGAPGMDHSHYGGVPPGSGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLPKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSSDKKTKGRTGWPQHVWALELKQ

hand2

Heart- and neural crest derivatives-expressed protein 2

210 amino acids

Essential for cardiac morphogenesis and for the development of branchial arches. Binds DNA on E-box consensus sequence 5'-CANNTG-3' (By similarity).

23.253 kDa

MSLVGGFPHHPVVHHDGYPFAAAAAAAASRCHEENPYFHGWLISHPEMSPPDYSMAPSYSPEYANGAAGLDHSHYGGVPGSGAGGLMQRPVKRRGTANRKERRRTISINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGETEAFKAEIKKTDVKEEKRKKELNELLKSTVCSNDKKTKGRTGWPQHVWALELKQ

hand2

Heart- and neural crest derivatives-expressed protein 2

208 amino acids

Essential for myocardial and pectoral fin differentiation, patterning and morphogenesis.

23.167 kDa

MSLVGGFPHHPVMHHDGYSFAAAAAASRCHEEPPYFHGWLISHPEMSPPDYTMAPSYSPEYSTGAPGLDHSHYGGVPGAGAVGMGPRTVKRRPTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDILDKDEQNGETEAFKAEFKKTDAKEERRKKEMNDVLKSSGSSNDKKTKGRTGWPQHVWALELKQ