About Products Protein Database Contact

Gr93c

Gene
Gr93c
Protein
Putative gustatory receptor 93c
Organism
Drosophila melanogaster
Length
397 amino acids
Function
Probable gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates.
Similarity
Belongs to the insect chemoreceptor superfamily. Gustatory receptor (GR) family. Gr93a subfamily.
Mass
46.253 kDa
Sequence
MIERLKKVSLPALSAFILFCSCHYGRILGVICFDIGQRTSDDSLVVRNRHQFKWFCLSCRLISVTAVCCFCAPYVADIEDPYERLLQCFRLSASLICGICIIVVQVCYEKELLRMIISFLRLFRRVRRLSSLKRIGFGGKREFFLLLFKFICLVYELYSEICQLWHLPDSLSLFATLCEIFLEIGSLMIIHIGFVGYLSVAALYSEVNSFARIELRRQLRSLERPVGGPVGRKQLRIVEYRVDECISVYDEIERVGRTFHRLLELPVLIILLGKIFATTILSYEVIIRPELYARKIGMWGLVVKSFADVILLTLAVHEAVSSSRMMRRLSLENFPITDHKAWHMKWEMFLSRLNFFEFRVRPLGLFEVSNEVILLFLSSMITYFTYVVQYGIQTNRL