GLRX2

Glutaredoxin-2, mitochondrial

164 amino acids

Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.

Belongs to the glutaredoxin family.

18.052 kDa

MIWRRAALAGTRLVWSRSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ

GLRX2

Glutaredoxin-2, mitochondrial

161 amino acids

Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release (By similarity).

Belongs to the glutaredoxin family.

17.888 kDa

MLWRRAALAGTRLVWSRSGSAGWLDRAAGAAATAASGMESNTSSSLENLETAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFRDMNVNYKVVELDLLEYGNQFQDALYKMTGGRTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ

Glrx2

Glutaredoxin-2, mitochondrial

157 amino acids

Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release (By similarity).

Belongs to the glutaredoxin family.

17.275 kDa

MSWYRAASVGRRLVASGRILAGRRGAAGAAGSGMGNSTSSFWGKSATTPVNQIQETISNNCVVIFSKSSCSYCSMAKKIFHDMNVNYKVVELDMVEYGSQFQEALYKMTGERTVPRIFVNGIFIGGAADTHRLHKEGKLLPLVHQCYLNKSKRKDVE

GLRX2

Glutaredoxin-2, mitochondrial

157 amino acids

Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release (By similarity).

Belongs to the glutaredoxin family.

17.202 kDa

MYWRRAALVGTRLIPVRSSSAGRLEGPAGISGSGMGNSTSSSLGNAATAPVNQIQETISNNCVVIFSKTSCSYCTMAKNLFHDMNVNYKVVELDMLEYGSQFQDALHKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCHLKNSKREEL

Glrx2

Glutaredoxin-2, mitochondrial

156 amino acids

Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.

Belongs to the glutaredoxin family.

17.307 kDa

MSWRRAASVGRRLVASGRILAGRRGAAGAAGSGMGNSTSSFWGKSTTTPVNQIQETISNNCVVIFSKTSCSYCSMAKKIFHDMNVNYKAVELDMLEYGNQFQDALHKMTGERTVPRIFVNGRFIGGAADTHRLHKEGKLLPLVHQCYLKKKQEERH