Gja6

Gap junction alpha-6 protein

286 amino acids

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Belongs to the connexin family. Alpha-type (group II) subfamily.

32.86 kDa

MSDWSALHQLLEKVQPYSTAGGKVWIKVLFIFRILLLGTAIESAWSDEQFEFHCNTQQPGCENVCYDQAFPISHVRLWVLQVIFVSVPTLLHLAHVYYVIRQNEKLKKQEEEELKVAHFNGASGERRLQKHTGKHIKCGSKEHGNRKMRGRLLLTYMASIFFKSVFEVAFLLIQWYLYGFTLSAVYICEQSPCPHRVDCFLSRPTEKTIFILFMLVVSMVSFVLNVIELFYVLFKAIKNHLGNEKEEVYCNPVELQKPSCVSSSAVLTTICSSDQVVPVGLSSFYM

Gja6

Gap junction alpha-6 protein

283 amino acids

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Belongs to the connexin family. Alpha-type (group II) subfamily.

32.66 kDa

MSDWSALHQLLEKVQPYSTAGGKVWIKVLFIFRILLLGTAIESAWSDEQFEFHCNTQQPGCENVCYDHAFPISHVRLWVLQVIFVSVPILLYLAHVYYVVRQNKKLNKQEEELEAAHFNEASVERHLETIAGEQFKCGSEEQSKVKMRGRLLLTYMASIFFKSVFEMAFLLIQWYIYGFTLSALYICEQSPCPRRVDCFLSRPTEKTIFILFMFVVSVVSFVLDIIELFYVLFKAIKNRMRKAEDEVYCDELPCPSHVSSSTVLTTIDSSEQAVPVELSSVCI