gtf2h3

General transcription factor IIH subunit 3

372 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription.

Belongs to the TFB4 family.

41.702 kDa

MNNEGSAVINEDDDTSLLVVILDCNVYSWGNREKSLQDAISGMNDDNDSSSRYNGSTTIGNNNNNNNNNNSNNNNNVNKRLINTSKNNYIGFNKFLEHFMVFINAYLMLNQENQLAIICSKIGESSFVFPQSNIDQYQQEQQELEQRQLNENGELLPTPNKTIQGQILAKLQKLDLEIKHDQTDILSSSFSASMSIALCYINRIKRETPTIKPRILVFNISPDVSSQYISVMNCIFSSQKQSIPVDSCILSQSDSTFLQQASHLTSGIYLKPQKQELLSQYLLTTFLLDTLSRKSLAYPTLKSVDYRASCFCHKRIVDIGYVCSVCLSIFCGHSSSCSTCGTKFSLKIDLRKQLNNNPTTTTSATSTVNNKS

GTF2H3

General transcription factor IIH subunit 3

309 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription.

Belongs to the TFB4 family.

34.491 kDa

MVSDEDELNLLVIIVDTNPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPSSEFTPSGSKDGKYELLTAANEVIAEEIKDLMTKSDIEGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKMSS

Gtf2h3

General transcription factor IIH subunit 3

309 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription.

Belongs to the TFB4 family.

34.244 kDa

MAADEDELNLLVIIVDTNPIWWGKQALKESQFTLSKCMDAVMVLANSHLFMNRSNQLAVIASHIQESRLLYPGKNGGLGDFFGDPGNALPDCNPSGSKDGKYELLTVANEVIAEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRVNKAVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPIHVDYRAACFCHRSLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKQKVSL

Gtf2h3

General transcription factor IIH subunit 3

309 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription.

Belongs to the TFB4 family.

34.278 kDa

MAADEDELNLLVIIVDTNPIWWGKQALKESQFTLSKCMDAVMVLANAHLFMNRSNQLAVIASHIQESRFLYPGKNGRLGDFFGDPGNALPDCNPSGSKDGKYELLTAANEVIAEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRASKAVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPIHVDYRAACFCHRSLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKQKVSL

GTF2H3

General transcription factor IIH subunit 3

308 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription.

Belongs to the TFB4 family.

34.378 kDa

MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA