gtf2h2

General transcription factor IIH subunit 2

461 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription.

Belongs to the GTF2H2 family.

51.959 kDa

MSKNIYNNNAQNKRTNRSLYDDEDGPAHVLQTNDEDGTNKYKWENRFEKTWLTIDEDEHGLRPSNQEERNTRNRRLKNKDRDGILSQDQRVRRGMQRHLCLILDLSKTLSNQDLKPSRYQVLLQNVELFIKEFFDQNPISQLSIIITKNSKAEKISELSGNRLRHIQAMKDAIAMEGEPSIQNSLEVALSSLCYVPKYGSREVLFIFSSLTTCDPSSLQKTIQSLKNESIRVSFIHMAAELYICKAIAEQTNGTSKVILNEEHFNESLMLKCQPPPTIGKTEAALVEMGFPQQITSTVPSPCICHEKMKYSGYICPRCGVKSCELPTDCQICNLSLVSSPHLARSYHHLFQIPLFNEVNWKELNKNVTCIGCLSSSEKSILSLFFSCPRCQEIFCLDCDLFIHESLHNCPGCENKLQNTNTNTNGKTNGNEITNGNGNGNGNENENGNGNGNGNGNGNGLH

GTF2H2

General transcription factor IIH subunit 2

421 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription (By similarity). Can restore UV resistance in the NER-deficient ssl1-1 yeast mutant (PubMed:16623910).

Belongs to the GTF2H2 family.

46.978 kDa

MSNQRKRSNDEREEEDDEDAEGIGEWERAYVDDRSWEELQEDESGLLRPIDNSAIYHAQYRRRLRMLSAAAAGTRIQKGLIRYLYIVIDFSRAAAEMDFRPSRMAIMAKHVEAFIREFFDQNPLSQIGLVSIKNGVAHTLTDLGGSPETHIKALMGKLEALGDSSLQNALELVHEHLNQVPSYGHREVLILYSALCTCDPGDIMETIQKCKKSKLRCSVIGLSAEMFICKHLCQETGGLYSVAVDEVHLKDLLLEHAPPPPAIAEFAIANLIKMGFPQRAAEGSMAICSCHKEVKIGAGYMCPRCKARVCDLPTECTICGLTLVSSPHLARSYHHLFPIAPFDEVPALSSLNDNRRKLGKSCFGCQQSLIGAGNKPVPCVTCRKCKHYFCLDCDIYIHESLHNCPGCESIHRPKSVSLMEE

Gtf2h2

General transcription factor IIH subunit 2

396 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. The N-terminus of GTF2H2 interacts with and regulates XPD whereas an intact C-terminus is required for a successful escape of RNAP II form the promoter.

Belongs to the GTF2H2 family.

44.687 kDa

MDEEPERTKRWEGGYERTWEILKEDETGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDETHYKELLAHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDNNSTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEISLEEYKGERFCYGCQGELKDQHVYVCTVCQNVFCVDCDVFVHDSLHCCPGCIHKIPTPSGI

Gtf2h2

General transcription factor IIH subunit 2

396 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. The N-terminus of GTF2H2 interacts with and regulates XPD whereas an intact C-terminus is required for a successful escape of RNAP II form the promoter.

Belongs to the GTF2H2 family.

44.703 kDa

MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDETHYKELLARHVSPPPASSGSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDNNSTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYKGERFCYGCQGELKDQHVYVCTVCRNVFCVDCDVFVHDSLHCCPGCVHKIPTQSGV

GTF2H2

General transcription factor IIH subunit 2

395 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. The N-terminus of GTF2H2 interacts with and regulates XPD whereas an intact C-terminus is required for a successful escape of RNAP II form the promoter.

Belongs to the GTF2H2 family.

44.512 kDa

MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKSLKAAKIRVSIIGLSAEVRVCTALARETGGTYHVILDESHYKELLTHHVSPPPASSNSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDSNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEHNGERFCYACQGELKDQHVYVCSVCQNVFCVDCDVFVHDSLHCCPGCIHKIPVPSGI

GTF2H2

General transcription factor IIH subunit 2

395 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. The N-terminus of GTF2H2 interacts with and regulates XPD whereas an intact C-terminus is required for a successful escape of RNAP II form the promoter.

Belongs to the GTF2H2 family.

44.419 kDa

MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV