gtf2f2

General transcription factor IIF subunit 2

264 amino acids

TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity (By similarity).

Belongs to the TFIIF beta subunit family.

30.14 kDa

MSAEKGELDLNGAKQNTGMWLVKLPKYLAQQWAKATGRGEVGKLRIVKNQGKTEVSFTLNEELASIQDIGGKPASSLVSTPREHPFLLQSVGGQTLTVLTESLSGQSEDKSENRVIDKLALEGIVVHRAECRPAASDNYMQMKRKQIEESSKPKRQSQQLEKAVTSNYKPVSNHQYNIEYEKKKKDDGKRARVDKHQVLDMLFSAFEKHQYYNIKDLVDITKQPVTYLKEILRDIGIYNMKGTHKNTWELKPEYRHYQGEDKSD

GTF2F2

General transcription factor IIF subunit 2

249 amino acids

TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity (By similarity).

Belongs to the TFIIF beta subunit family.

28.446 kDa

MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKAPGRGEVGKLRIAKNQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAANENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVSYLKDILKEIGVQNVKGIHKNTWELKPEYRHYQVEEKSD

GTF2F2

General transcription factor IIF subunit 2

249 amino acids

TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity.

Belongs to the TFIIF beta subunit family.

28.38 kDa

MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD

Gtf2f2

General transcription factor IIF subunit 2

249 amino acids

TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity (By similarity).

Belongs to the TFIIF beta subunit family.

28.381 kDa

MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKNQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMKLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVGYLKEILKEIGIQNVKGIHKNTWELKPEYRHYQTEEKSD

Gtf2f2

General transcription factor IIF subunit 2

249 amino acids

TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity (By similarity).

Belongs to the TFIIF beta subunit family.

28.349 kDa

MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKAPGRGEVGKLRIAKNQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMKLKRLQIEESSKPVRLSQQADKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVGYLKEILKEIGIQNVKGIHKNTWELKPEYRHYQTEEKSD

gtf2f2

General transcription factor IIF subunit 2

241 amino acids

TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity (By similarity).

Belongs to the TFIIF beta subunit family.

27.535 kDa

MSEEKNDALVGEVNTDNADNQVWLIKVPKFLSESWQKIGQGEIGQIHIKGGDNISLSYGPDVGQEFQLITTANTLDNQPLKIFSEDKDGALALEGNIGLRCDIKIDVESPQYRDLMKSRHTKYNTKTRMTQVIDESELFTPTLFDANKVKVSTVGITQKKKSTDKKEKLPEDEVLDLIFSAFRAEKHLDLKTLESFTEQPKNHLKTILEKVCILNKRGPYHHLYELKPEFRDKDNSKDEKK