GSKIP

GSK3B-interacting protein

139 amino acids

A-kinase anchoring protein for GSK3B and PKA that regulates or facilitates their kinase activity towards their targets. The ternary complex enhances Wnt-induced signaling by facilitating the GSK3B- and PKA-induced phosphorylation of beta-catenin leading to beta-catenin degradation and stabilization respectively. Upon cAMP activation, the ternary complex contributes to neuroprotection against oxidative stress-induced apoptosis by facilitating the PKA-induced phosphorylation of DML1 and PKA-induced inactivation of GSK3B. During neurite outgrowth promotes neuron proliferation; while increases beta-catenin-induced transcriptional activity through GSK3B kinase activity inhibition, reduces N-cadherin level to promote cell cycle progression (By similarity). May play a role in cleft palate formation and is required for postnatal life through modulation of the activity of GSK3B during development (By similarity).

Belongs to the GSKIP family.

15.714 kDa

METDCNPMELSGVSGFEEEAELNGFEGTDMKDMRLEAEAVVNDVLFAVNTMFVSKTLRCADDVAYINVETRERNRYCLELTEAGLRVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKREGQS

GSKIP

GSK3-beta interaction protein

139 amino acids

Belongs to the GSKIP family.

15.885 kDa

METDCSPMELTNNTESEEDSDYRDFEEADVKDMRLEAEAVVNDVLFAVSNMFVSKTLPCAEDVAYINVETRERGRYCVELTDSGLRVVAYDFDQTDDSLQNPYHETVYSLLDTLSPAYREVFGNALLQRLEALKRDSQS

GSKIP

GSK3B-interacting protein

139 amino acids

A-kinase anchoring protein for GSK3B and PKA that regulates or facilitates their kinase activity towards their targets (PubMed:27484798, PubMed:25920809, PubMed:16981698). The ternary complex enhances Wnt-induced signaling by facilitating the GSK3B- and PKA-induced phosphorylation of beta-catenin leading to beta-catenin degradation and stabilization respectively (PubMed:27484798, PubMed:16981698). Upon cAMP activation, the ternary complex contributes to neuroprotection against oxidative stress-induced apoptosis by facilitating the PKA-induced phosphorylation of DML1 and PKA-induced inactivation of GSK3B (PubMed:25920809). During neurite outgrowth promotes neuron proliferation; while increases beta-catenin-induced transcriptional activity through GSK3B kinase activity inhibition, reduces N-cadherin level to promote cell cycle progression (PubMed:19830702).

Belongs to the GSKIP family.

15.648 kDa

METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVETKERNRYCLELTEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKRDGQS

GSKIP

GSK3-beta interaction protein

139 amino acids

A-kinase anchoring protein for GSK3B and PKA that regulates or facilitates their kinase activity towards their targets. The ternary complex enhances Wnt-induced signaling by facilitating the GSK3B- and PKA-induced phosphorylation of beta-catenin leading to beta-catenin degradation and stabilization respectively. Upon cAMP activation, the ternary complex contributes to neuroprotection against oxidative stress-induced apoptosis by facilitating the PKA-induced phosphorylation of DML1 and PKA-induced inactivation of GSK3B. During neurite outgrowth promotes neuron proliferation; while increases beta-catenin-induced transcriptional activity through GSK3B kinase activity inhibition, reduces N-cadherin level to promote cell cycle progression (By similarity). May play a role in cleft palate formation and is required for postnatal life through modulation of the activity of GSK3B during development (By similarity).

Belongs to the GSKIP family.

15.692 kDa

METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVETKERNRYCLELTEAGLKVVGYDFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKRDGQS

Gskip

GSK3B-interacting protein

139 amino acids

A-kinase anchoring protein for GSK3B and PKA that regulates or facilitates their kinase activity towards their targets. The ternary complex enhances Wnt-induced signaling by facilitating the GSK3B- and PKA-induced phosphorylation of beta-catenin leading to beta-catenin degradation and stabilization respectively. Upon cAMP activation, the ternary complex contributes to neuroprotection against oxidative stress-induced apoptosis by facilitating the PKA-induced phosphorylation of DML1 and PKA-induced inactivation of GSK3B. During neurite outgrowth promotes neuron proliferation; while increases beta-catenin-induced transcriptional activity through GSK3B kinase activity inhibition, reduces N-cadherin level to promote cell cycle progression (By similarity). May play a role in cleft palate formation and is required for postnatal life through modulation of the activity of GSK3B during development (PubMed:26582204).

Belongs to the GSKIP family.

15.642 kDa

METDYNPVELSSMSGFEEGSELNGFEGADMKDMQLEAEAVVNDVLFAVNHMFVSKSMPCADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQVEDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKRDGQS

Gskip

GSK3B-interacting protein

139 amino acids

A-kinase anchoring protein for GSK3B and PKA that regulates or facilitates their kinase activity towards their targets. The ternary complex enhances Wnt-induced signaling by facilitating the GSK3B- and PKA-induced phosphorylation of beta-catenin leading to beta-catenin degradation and stabilization respectively. Upon cAMP activation, the ternary complex contributes to neuroprotection against oxidative stress-induced apoptosis by facilitating the PKA-induced phosphorylation of DML1 and PKA-induced inactivation of GSK3B. During neurite outgrowth promotes neuron proliferation; while increases beta-catenin-induced transcriptional activity through GSK3B kinase activity inhibition, reduces N-cadherin level to promote cell cycle progression (By similarity). May play a role in cleft palate formation and is required for postnatal life through modulation of the activity of GSK3B during development (By similarity).

Belongs to the GSKIP family.

15.557 kDa

METDCNPVDLSSMSGFEEGSELNGFEGTDMKDMQLEAEAVVNDVLFAVNNMFVSKSLPCADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQVEDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKRDGQS

gskip

GSK3-beta interaction protein

139 amino acids

Belongs to the GSKIP family.

15.515 kDa

MEVDYNPMDLPVNTVYEDESEFRDLEGTDVKDMCLEAEAIVNDVLFAVGNMFVSKTLPCAVDVAYINVEIKEGTRYCLELTDAGLRVAGYAFDHLAEGLCSQYHETVYSLLDSLSPAYREAFGNALLQRLEALKRDGQS

gskip

GSK3-beta interaction protein

133 amino acids

Belongs to the GSKIP family.

14.918 kDa

MEVDCKPEDLSKCSYDERCVELGEVKDMRLEAEAVVNDVLFAVSDMHVSHNLSSGLDVAYINVETREGNRYCLELTEAGLKVVGHTFDKVNDGLSSQYHETVYSLLDSLSPGYREAFGNALLQRLERLKQNGQ