About Products Protein Database Contact

GRF5

Gene
GRF5
Protein
Growth-regulating factor 5
Organism
Arabidopsis thaliana
Length
397 amino acids
Function
Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Acts together with GIF1 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia.
Similarity
Belongs to the GRF family.
Mass
44.696 kDa
Sequence
MMSLSGSSGRTIGRPPFTPTQWEELEHQALIYKYMVSGVPVPPELIFSIRRSLDTSLVSRLLPHQSLGWGCYQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLDQNQTTTTPLTSPSLSFTNNNNPSPTLSSSSSSNSSSTTYSASSSSMDAYSNSNRFGLGGSSSNTRGYFNSHSLDYPYPSTSPKQQQQTLHHASALSLHQNTNSTSQFNVLASATDHKDFRYFQGIGERVGGVGERTFFPEASRSFQDSPYHHHQQPLATVMNDPYHHCSTDHNKIDHHHTYSSSSSSQHLHHDHDHRQQQCFVLGADMFNKPTRSVLANSSRQDQNQEEDEKDSSESSKKSLHHFFGEDWAQNKNSSDSWLDLSSHSRLDTGS

Gene
GRF5
Protein
Growth-regulating factor 5
Organism
Oryza sativa subsp. japonica
Length
348 amino acids
Function
Transcription activator that plays a regulatory role in gibberellin-induced stem elongation.
Similarity
Belongs to the GRF family.
Mass
37.815 kDa
Sequence
MLSSSPSAAAPGIGGYQPQRGAAVFTAAQWAELEQQALIYKYLVAGVPVPGDLLLPIRPHSSAAATYSFANPAAAPFYHHHHHPSLSYYAYYGKKLDPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVESKTAAPAPQSQPQLSNVTTATHDTDAPLPSLTVGAKTHGLSLGGAGSSQFHVDAPSYGSKYSLGAKADVGELSFFSGASGNTRGFTIDSPTDSSWHSLPSSVPPYPMSKPRDSGLLPGAYSYSHLEPSQELGQVTIASLSQEQERRSFGGGAGGMLGNVKHENQPLRPFFDEWPGRRDSWSEMDEERSNQTSFSTTQLSISIPMPRCD

Gene
GRF5
Protein
14-3-3-like protein GF14 upsilon
Organism
Arabidopsis thaliana
Length
268 amino acids
Function
Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes. May be involved in cell cycle regulation by binding to soluble EDE1 and sequestering it in an inactive form during the early stages of mitosis.
Similarity
Belongs to the 14-3-3 family.
Mass
30.182 kDa
Sequence
MSSDSSREENVYLAKLAEQAERYEEMVEFMEKVAKTVETEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEDSRGNSDHVSIIKDYRGKIETELSKICDGILNLLEAHLIPAASLAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLVAYKSAQDIALADLAPTHPIRLGLALNFSVFYYEILNSSDRACSLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDLNDEAGDDIKEAPKEVQKVDEQAQPPPSQ