About Products Protein Database Contact

GRA7

Gene
GRA7
Protein
Dense granule protein 7
Organism
Toxoplasma gondii
Length
236 amino acids
Similarity
Belongs to the Gra7 family.
Mass
25.858 kDa
Sequence
MARHAIFSALCVLGLVAAALPQFATAATASDDELMSRIRNSDFFDGQAPVDSLRPTNAGVDSKGTDDHLTTSMDKASVESQLPRREPLETEPDEQEEVHFRKRGVRSDAEVTDDNIYEEHTDRKVVPRKSEGKRSFKDLLKKLALPAVGMGASYFAADRLVPELTEEQQRGDEPLTTGQNVGTVLGFAALAAAAAFLGMGLTRTYRHFSPRKNRSRQPALEQEVPESGEDGEDARQ