GNRHR2

Gonadotropin-releasing hormone II receptor

380 amino acids

Receptor for gonadotropin releasing hormone II (GnRH II). This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Belongs to the G-protein coupled receptor 1 family.

41.991 kDa

MSAVNGTPWGSSAREEVWAGSGVEVEGSELPTFSTAAKVRVGVTIVLFVSSAGGNLAVLWSVTRPQPSQLRPSPVRRLFAHLAAADLLVTFVVMPLDATWNITVQWLAGDIACRTLMFLKLMAMYAAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLALPQLFLFHTVHRAGPVPFTQCATKGSFKARWQETTYNLFTFCCLFLLPLTAMAICYSRIVLGVSSPRTRKGSHAPAGEFALRRSFDNRPRVRLRALRLALLVLLTFILCWTPYYLLGLWYWFSPSMLSEVPPSLSHILFLFGLLNAPLDPLLYGAFTLGCRRGHQELSMDSSREEGSRRMFQQDIQALRQTEVQKTVTSRKAGETKDIPITSI

GNRHR2

Gonadotropin-releasing hormone II receptor

379 amino acids

Receptor for gonadotropin releasing hormone II (GnRH II). This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Belongs to the G-protein coupled receptor 1 family.

41.435 kDa

MSAGNGTPWGSAVGEEAWAGSGVAVEGSELPTFSTAAKVRVGVTIVLFVSSAGGNLAVLWSVTRPQPSQLRPSPVRTLFAHLAAADLLVTFVVMPLDATWNITVQWLAGDIACRTLMFLKLMAMYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLALPQLFLFHTVHRAGPVPFTQCVTKGSFKARWQETTYNLFTFCCLFLLPLIAMAICYSRIVLSVSSPQTRKGSHAPAGEFALRRSFDNRPRVCLRALRLALLILLTFILCWTPYYLLGLWYWFSPTMLTEVPPSLSHILFLFGLLNAPLDPLLYGAFTFGCRRGHQELSIDSSKEGSGRMLQQEIHALRQQEVQKTVTSRSAGETKGISITSI

GNRHR2

Gonadotropin-releasing hormone II receptor

379 amino acids

Receptor for gonadotropin releasing hormone II (GnRH II). This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Belongs to the G-protein coupled receptor 1 family.

41.459 kDa

MSAGNGTPWGSAAGEESWAASGVAVEGSELPTFSAAAKVRVGVTIVLFVSSAGGNLAVLWSVTRPQPSQLRPSPVRTLFAHLAAADLLVTFVVMPLDATWNITVQWLAEDIACRTLMFLKLMAMYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLALPQLFLFHTVHRAGPVPFTQCVTKGSFKARWQETTYNLFTFRCLFLLPLTAMAICYSHIVLSVSSPQTRKGSHAPAGEFALCRSFDNCPRVRLWALRLALLILLTFILCWTPYYLLGLWYWFSPTMLTEVPPSLSHILFLFGLLNAPLDPLLYGAFTLGCQRGHQELSIDSSNEGSGRMLQQEIHALRQQEVQKTVTSRSAGETKDISITSI

GNRHR2

Putative gonadotropin-releasing hormone II receptor

292 amino acids

Putative receptor for gonadotropin releasing hormone II (GnRH II) which is most probably non-functional.

Belongs to the G-protein coupled receptor 1 family.

32.537 kDa

MSAGNGTPWDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLAFPQLFLFHTVHCAGPVPFTQCVTKGSFKAQWQETTYNLFTFCCLFLLPLTAMAICYSRIVLSVSRPQTRKGSHAPAGEFALPRSFDNCPRVRLRALRLALLILLTFILCWTPYYLLGMWYWFSPTMLTEVPPSLSHILFLLGLLNAPLDPLLYGAFTLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI