GNG3

Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3

75 amino acids

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

Belongs to the G protein gamma family.

8.305 kDa

MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL

GNG3

Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3

75 amino acids

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

Belongs to the G protein gamma family.

8.305 kDa

MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL

Gng3

Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3

75 amino acids

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

Belongs to the G protein gamma family.

8.305 kDa

MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL