GNG10

Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10

68 amino acids

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Interacts with beta-1 and beta-2, but not with beta-3.

Belongs to the G protein gamma family.

7.205 kDa

MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL

Gng10

Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10

68 amino acids

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Interacts with beta-1 and beta-2, but not with beta-3 (By similarity).

Belongs to the G protein gamma family.

7.229 kDa

MSSGASVSALQRLVEQLKLEAGVERIKVSQAAAELQQYCIQNACKDALLLGVPAGSNPFREPRSCALL