Function
Glycerophosphodiester transporter that mediates uptake of glycerophosphoinositol (GroPIns) as a source of inositol and phosphate (PubMed:21984707, PubMed:24114876). Does not possess detectable glycerophosphocholine (GroPCho) transport activity (PubMed:21984707). Although no glycerophosphoinositol transport activity occurs in the absence of GIT1, C.albicans is still able to use glycerophosphoinositol as a phosphate source at pH 7.5, albeit slowly (PubMed:21984707). Thus, a second, GIT1-independent, mechanism must exist for utilizing glycerophosphoinositol as a phosphate source at physiological pH (PubMed:21984707, PubMed:24114876). The expanded ability to utilize GroPIns and GroPCho results from the organism's pathogenic nature and its need to occupy a variety of environments within its host organism (PubMed:21984707). This possibility is buttressed by the fact that GroPIns and GroPCho are present and abundant in human fluids (PubMed:21984707, PubMed:24114876).
Sequence
MSDLVKSSEVIETTEVPPHNNNNNKRHFKYDSEQRKQRLAGGVKLKDALMILCAGFALISDGYQNNVMSMMNKVFALEYPKEYTASLSTQVSNASLVGTIFGQVIIGLTADYIGRKWSIVTATCFLIFGTMMCAASHGKTVNGMFWMLTIFRGVTGFGIGAEYPSSSVTASEAANESVKRRGGAFILATNLPLSFGGPFALCIFLIVRRICGNHLDAIWRTMFAIGCFWPLSVFYFRLKMVTSELYTKSAIKQRAPYWLALKYYWPRLIGTCVAWFLYDFVTFPNGIFSAGIISNVIPKSEKNNLEKIAEWNLLLGAIALPGVFVGAYVVDILGRKYTMMIGFCGYIVFGLIVGCGYHQIKPITGLFIVFYGLMMSCGNFGPGNNMGLTSSESFATPIRGTAYGISAAIGKVGAVVGTKTFSPIQKNLGDKWTFIIAAICGLAGVLVTFIFIPHLKDEDLLEEDVKFKNYLIDNGWKGKFGIQEYDEEEDLEGSSEDSSDGEIVKNNTKNDVEKVDALK