GET4

Golgi to ER traffic protein 4 homolog

328 amino acids

As part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Recruited to ribosomes, it interacts with the transmembrane region of newly synthesized tail-anchored proteins and together with SGTA and ASNA1 mediates their delivery to the endoplasmic reticulum. Client proteins that cannot be properly delivered to the endoplasmic reticulum are ubiquitinated and sorted to the proteasome. Similarly, the BAG6/BAT3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The BAG6/BAT3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome.

Belongs to the GET4 family.

36.529 kDa

MAAAIMAAEQEAAKGGGGRNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMSQGKHAEARELMYSGALLFFSHNQQNSAADLSMLVLESLEKSDAKVAEDLLENLAKLFSLMDPNSPERVAFVSRALKWSSGGSGKLGHPKLHQLLAITLWKEQNYSESRYHFLHSTDGEGCANMLVEYSSSRGYRSEVDMFVAQAVLQFLCLKNKTSASVVFTTYTQKHPSIEKGPPFVQPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSLKRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLNSLMGTGEDDDTEEGQEDSSPIELD

GET4

Golgi to ER traffic protein 4 homolog

327 amino acids

As part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation (PubMed:20676083, PubMed:21636303, PubMed:21743475, PubMed:28104892). The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Recruited to ribosomes, it interacts with the transmembrane region of newly synthesized tail-anchored proteins and together with SGTA and ASNA1 mediates their delivery to the endoplasmic reticulum (PubMed:20676083, PubMed:28104892, PubMed:25535373). Client proteins that cannot be properly delivered to the endoplasmic reticulum are ubiquitinated and sorted to the proteasome (PubMed:28104892). Similarly, the BAG6/BAT3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum (PubMed:21743475). The BAG6/BAT3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome (PubMed:21636303).

Belongs to the GET4 family.

36.504 kDa

MAAAAAMAEQESARNGGRNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMSQSKHTEARELMYSGALLFFSHGQQNSAADLSMLVLESLEKAEVEVADELLENLAKVFSLMDPNSPERVTFVSRALKWSSGGSGKLGHPRLHQLLALTLWKEQNYCESRYHFLHSADGEGCANMLVEYSTSRGFRSEVDMFVAQAVLQFLCLKNKSSASVVFTTYTQKHPSIEDGPPFVEPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIELD

Get4

Golgi to ER traffic protein 4 homolog

327 amino acids

As part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Recruited to ribosomes, it interacts with the transmembrane region of newly synthesized tail-anchored proteins and together with SGTA and ASNA1 mediates their delivery to the endoplasmic reticulum. Client proteins that cannot be properly delivered to the endoplasmic reticulum are ubiquitinated and sorted to the proteasome. Similarly, the BAG6/BAT3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The BAG6/BAT3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome.

Belongs to the GET4 family.

36.525 kDa

MAAAAAMAEQEGARNGARNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMSQSKHAEARELMYSGALLFFSHGQQNSAADLSMLVLESLEKAEVDVADELLENLAKVFSLMDPNSPERVAFVSRALKWSSGGSGKLGHPRLHQLLALTLWKEQNYCESRYHFLHSSDGEGCANMLVEYSTARGFRSEVDMFVAQAVLQFLCLKNKNSALVVFTTYTQKHPSIEDGPPFVQPLLNFIWFLLLAVDGGKLAVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLSSLMGSSEQEEGEESQDDSSPIELD

GET4

Golgi to ER traffic protein 4 homolog

325 amino acids

As part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Recruited to ribosomes, it interacts with the transmembrane region of newly synthesized tail-anchored proteins and together with SGTA and ASNA1 mediates their delivery to the endoplasmic reticulum. Client proteins that cannot be properly delivered to the endoplasmic reticulum are ubiquitinated and sorted to the proteasome. Similarly, the BAG6/BAT3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The BAG6/BAT3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome.

Belongs to the GET4 family.

36.185 kDa

MAAAAMAEQESARNGARNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMAQSKHAEARELMCSGALLFFSHGQQNSAADLSMLVLESLEKAEVEVADELLESLAKLFSLMDPNSPERVAFVSRALKWSSGGSGKLGHPRLHQLLALTLWKEQNYCESRYHFLHSSDGEGCANMLVEYSTARGFRSEVDMFVAQAVLQFLCLKNKSSASVVFTTYTQKHPSIEGGPPFVQPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLSSLMGSSEQEGEDSQDDSSPIELD

get4

Golgi to ER traffic protein 4 homolog

325 amino acids

As part of a cytosolic protein quality control complex, the bag6/bat3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The bag6/bat3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Similarly, the bag6/bat3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The bag6/bat3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome.

Belongs to the GET4 family.

36.643 kDa

MAAAMAEQDGSKGSARNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMSQSKHIEARELMYSGALLFFSHSQQNSAADLSMLVLESLEKHEVKVTEELLENLAKLFSLMDPNSPERVAFVSRALKWSSGGSGKFGHPKLHQFLAITLWKEQNYYESRYHFLHSSDGEGCANMLVEYSSTRGYRSEVDMFVAQAVLQFLCLKNKTSASVVFTTYTQKHPSIERGPPFVQPLLNFIWFLLLAVEGGKLTVFTVLCEQYQPSLKRDPMYNEYLDRIGQLFFGVPPKQSSSYGGLLGNLLNSLMGSGEDDDVEDGQEDSSPIELD

get4

Golgi to ER traffic protein 4 homolog

323 amino acids

As part of a cytosolic protein quality control complex, the bag6/bat3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The bag6/bat3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Similarly, the bag6/bat3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The bag6/bat3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome.

Belongs to the GET4 family.

36.572 kDa

MSDPESLRCSSVRNRGGVQRVEGKLRASVERGDYYEAHQMYRTLFFRYMSQAKHAEARELMYRGALLFFSHNQQNSAADLSMLVLEVLEKSDAKVEDEILEHLAKLFSLMDQNSPERAAFVSRALKWSTGGSSKLGHPKLHQLLALTLWKEQNYSESRYHFLHSSDGEGCAQMLVEYWASRGYRNEVDLFVAQAVLQFLCLKNKSSASVVFSTYTEKHPSIQKGPPFVQPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSLKRDPMYNEYLDRIGQLFFGVPPKQSPSYGGLLGNLLNSLMGSGEDDDGVEEAQEDSSPIELD

get4

Golgi to ER traffic protein 4 homolog

323 amino acids

As part of a cytosolic protein quality control complex, the bag6/bat3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The bag6/bat3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Similarly, the bag6/bat3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The bag6/bat3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome.

Belongs to the GET4 family.

36.415 kDa

MSEQESLRCSSARNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLYFRYMSQAKHAEARELMYNGALLFFSYNQQNSAADLSMLVLEVLEKSKGKVEDEILECLVKLFSLMDQNSPERVAFVSRALKWSTGGSGKLGHPRLHQLLALTLWKEQNYSESXYHFLHSSDGEGCAQMLVEYSASRGFHSEVDMFVAQAVLQFLCLKNKNGASVVXSTYTEKHPSIEKGPPFVQPLLNFIWFLLLAVDGGKLTVFTVLCEQYKPSLKRDPMYNEYLDRIGQLFFGVPPKQSPSYGGLLGNLLNSLMGSGEEDDMAEEAQEDSSPIELD

get4

Golgi to ER traffic protein 4 homolog

322 amino acids

As part of a cytosolic protein quality control complex, the bag6/bat3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The bag6/bat3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Similarly, the bag6/bat3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The bag6/bat3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome.

Belongs to the GET4 family.

36.305 kDa

MSEQEALKCSSARNRGGTQRVEGKLRASVEKGDYYEAHQMYRTLFFRYISQAKHTDARELMYNGAQLFFSYNQLNSAADLSMLVLESLEKSEAKVEDEDLEHLAKLFSLMDPNSPERVAFVSRALKWSTGGSGKLGAPKLHQLLAVTLWKEQNYSESRYHFLHSSDGEGCAQMLVEYSAQRGFRSEVDMFVAQAVLQFLCLKNKNSASVVFSTYTQKHPSIEKDPPFVQPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSLKRDPMYNEYLDRIGQLFFGVPPKQSSSYGGLLGNLLNSLMGSGEDEEGEEAQEHGSPIELD

GET4

Golgi to ER traffic protein 4 homolog

312 amino acids

As part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Recruited to ribosomes, it interacts with the transmembrane region of newly synthesized tail-anchored proteins and together with SGTA and ASNA1 mediates their delivery to the endoplasmic reticulum. Client proteins that cannot be properly delivered to the endoplasmic reticulum are ubiquitinated and sorted to the proteasome. Similarly, the BAG6/BAT3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The BAG6/BAT3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome.

Belongs to the GET4 family.

34.648 kDa

MAAAIMAAEQEAAKGGGRNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMSQGKYVEARELMYSGALLFFSHNQQNSAADLSMLVLESLEKSDAKVTDDLLENLAKLFSLMDPNSPERVAFVSRALKWSSGGSGKLGHPKLHQLLAITLWKDGEGCANMLVEYSSSRGYRSEVDMFVAQAVLQFLCLKNKTSASVVFTTYTQKHPSIEKGPPFVQPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSLKRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLNSLMGTGEDDDTEDGQEDSSPIELD

GET4

Golgi to ER traffic protein 4

312 amino acids

May play a role in insertion of tail-anchored proteins into the endoplasmic reticulum membrane.

Belongs to the GET4 family.

36.28 kDa

MVPAESNAVQAKLAKTLQRFENKIKAGDYYEAHQTLRTIANRYVRSKSYEHAIELISQGALSFLKAKQGGSGTDLIFYLLEVYDLAEVKVDDISVARLVRLIAELDPSEPNLKDVITGMNNWSIKFSEYKFGDPYLHNTIGSKLLEGDFVYEAERYFMLGTHDSMIKYVDLLWDWLCQVDDIEDSTVAEFFSRLVFNYLFISNISFAHESKDIFLERFIEKFHPKYEKIDKNGYEIVFFEDYSDLNFLQLLLITCQTKDKSYFLNLKNHYLDFSQAYKSELEFLGQEYFNIVAPKQTNFLQDMMSGFLGGSK

get4

Golgi to ER traffic protein 4

303 amino acids

May play a role in insertion of tail-anchored proteins into the endoplasmic reticulum membrane.

Belongs to the GET4 family.

34.352 kDa

MDAKIKRAEGRLREDPYEGHQMLRTLVNRQVKAKKHDDAVALLYSGAKTLFEIEQTGSAADLAIYMLDVYEKASYAASLDNKARALTLLGLFPAEEGARKQYVKRLLEWSKSAGPQGDKDVHFAVATMFVKWKEPASAEKHFVLGNEKSARAYGETMYYWFTSDSSISPDTFAGRPVLNYLLAENLISAWNSLETFTKHFTKSNAPDVENMSFDGKDFPVFKEYPQMNFLHLLIFTAYRKDKETYLSLVQKYPKKQDWEAALAKIEEIYFGIRPVSNQPNILANLMSSLFSGPPAATNQLDLE