GEM

GLABRA2 expression modulator

299 amino acids

Involved in the spatial control of cell division, patterning and differentiation of Arabidopsis root epidermal cells. Could be part of a complex that negatively modulates GLABRA2 and CAPRICE expression via the maintenance of a repressor histone H3 epigenetics status of the GL2 and CPC promoters.

Belongs to the GEM family.

32.215 kDa

MEPPKGDTVVKTEVPVKDPSLSVVDSKTKGVEDANTEIALSDEVEIETKGSDSTPVKAPSRTSSGSKKSVHWSPELVSGSQEPDQKAASSSSAGSNPYIARSPAETSDASLKDTMETVKGVLGRWGKRVAEAAKKTESLAGNTWQHLRTAPSFADAAMGRIAQSTKVFAEGGYEKIFRQTFETDPEEQLLNSFACYLSTSAGPVMGVLYISSAKLAYCSDNPLSYKNGDQTEWSYYKVVIPLHQLKAVNPSASIVNPAEKYIQVISVDNHEFWFMGFLNYDGAVTSLQDSLQAGALRSV

GEM

GTP-binding protein GEM

296 amino acids

Could be a regulatory protein, possibly participating in receptor-mediated signal transduction at the plasma membrane. Has guanine nucleotide-binding activity but undetectable intrinsic GTPase activity.

Belongs to the small GTPase superfamily. RGK family.

33.949 kDa

MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKNMAFKLKSKSCHDLSVL

GEM

GTP-binding protein GEM

296 amino acids

Could be a regulatory protein, possibly participating in receptor-mediated signal transduction at the plasma membrane. Has guanine nucleotide-binding activity but undetectable intrinsic GTPase activity (By similarity).

Belongs to the small GTPase superfamily. RGK family.

33.98 kDa

MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRTCAVVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKNMAFKLKSKSCHDLSVL

Gem

GTP-binding protein GEM

295 amino acids

Could be a regulatory protein, possibly participating in receptor-mediated signal transduction at the plasma membrane. Has guanine nucleotide-binding activity but undetectable intrinsic GTPase activity.

Belongs to the small GTPase superfamily. RGK family.

33.725 kDa

MTLNNVTMRQGTVGMQPQQRWSIPADARHLMVQKDPHPCNLRNRHSTAPEEHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLVVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRRESIPRKARRFWGKIVAKNNKNMAFKLKSKSCHDLSVL