Gdf3

Growth/differentiation factor 3

366 amino acids

Growth factor involved in early embryonic development and adipose-tissue homeostasis. During embryogenesis controls formation of anterior visceral endoderm and mesoderm and the establishment of anterior-posterior identity through a receptor complex comprising the receptor ACVR1B and the coreceptor TDGF1/Cripto (PubMed:16368929, PubMed:17936261). Regulates adipose-tissue homeostasis and energy balance under nutrient overload in part by signaling through the receptor complex based on ACVR1C and TDGF1/Cripto.

Belongs to the TGF-beta family.

41.586 kDa

MQPYQRLLALGFLLLTLPWGQTSEFQDSDLLQFLGLEKAPSPHRFQPVPRVLRKIIRAREAAAASGASQDLCYVKELGVRGNLLQLLPDQGFFLNTQKPFQDGSCLQKVLYFNLSAIKEKAKLTMAQLTLDLGPRSYYNLRPELVVALSVVQDRGVWGRSHPKVGRLLFLRSVPGPQGQLQFNLQGALKDWSSNRLKNLDLHLEILVKEDRYSRVTVQPENPCDRLLRSLHASLLVVTLNPKHCHPSSRKRRAAISVPKGFCRNFCHRHQLFINFQDLGWHKWVIAPKGFMANYCHGECPFSMTTYLNSSNYAFMQALMHMADPKVPKAVCVPTKLSPISMLYQDSDKNVILRHYEDMVVDECGCG

GDF3

Growth/differentiation factor 3

364 amino acids

Growth factor involved in early embryonic development and adipose-tissue homeostasis. During embryogenesis controls formation of anterior visceral endoderm and mesoderm and the establishment of anterior-posterior identity through a receptor complex comprising the receptor ACVR1B and the coreceptor TDGF1/Cripto (By similarity). Regulates adipose-tissue homeostasis and energy balance under nutrient overload in part by signaling through the receptor complex based on ACVR1C and TDGF1/Cripto (PubMed:21805089).

Belongs to the TGF-beta family.

41.387 kDa

MLRFLPDLAFSFLLILALGQAVQFQEYVFLQFLGLDKAPSPQKFQPVPYILKKIFQDREAAATTGVSRDLCYVKELGVRGNVLRFLPDQGFFLYPKKISQASSCLQKLLYFNLSAIKEREQLTLAQLGLDLGPNSYYNLGPELELALFLVQEPHVWGQTTPKPGKMFVLRSVPWPQGAVHFNLLDVAKDWNDNPRKNFGLFLEILVKEDRDSGVNFQPEDTCARLRCSLHASLLVVTLNPDQCHPSRKRRAAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG

gdf3

Growth/differentiation factor 3

354 amino acids

Required for posterior mesoderm formation during embryogenesis. Acts indirectly to suppress head formation by altering mesodermal patterning. Also involved in the establishment of left-right axis asymmetry, acting upstream of nodal/nr-1. Can exert long-range effects in the embryo.

Belongs to the TGF-beta family.

40.317 kDa

MAELWLSLSCMFSLLLLTNSSPLTFQERMLLKALGLNTRPNPIAPAPVPKSLRDIFEKGINQDNPCMMEGFGVPGNIVRSYRDQGTIAAIEEPQGSLCLKKFLFFDLSAVENKEQLTLGQLEIKFKHNTYYGQQFHLRLYRTLQLSLKGMRDSKMNRKLLVTQSFRLLHKSLYFNLTKVAEDWKNPEKNMGLILEIYASSELAGGNRSFVVCEPIQSFIYTSLLTVSLDPSNCKTQRAKRSTHSSPPTPSNICKKRRLYIDFKDVGWQNWVIAPRGYMANYCHGECPYPLTEMLRGTNHAVLQTLVHSVEPENTPLPCCAPTKLSPISMLYYDNNDNVVLRHYEDMVVDECGCK