About Products Protein Database Contact

GD19634

Gene
GD19634
Protein
Enolase-phosphatase E1
Organism
Drosophila simulans
Length
256 amino acids
Function
Bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).
Similarity
Belongs to the HAD-like hydrolase superfamily. MasA/MtnC family.
Mass
28.32 kDa
Sequence
MSSGERVAKVVLVDIEGTTTSISFVHDVLFPYAKQNVEKFLRDFWKEDDIKHIVQDLKQVPKFADYKALLSAPPTEVDVELIAGFVRYLIDQDLKVTPMKTLQGLIWAQGYANGELKGHVYEDVPAAFEAWRAAGLRIAVYSSGSVAAQKLIFGHSLAGNLQPHLSAYFDTHVGHKQEQQSYENIAQQLKEDPKQILFLTDIPGEAAAARSAGLQAIILQRPGNAGLADDQKASFELIPDFKPLHNLKLPINKSQA