About Products Protein Database Contact

GADD45B

Gene
GADD45B
Protein
Growth arrest and DNA damage-inducible protein GADD45 beta
Organism
Bos taurus
Length
160 amino acids
Function
Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK (By similarity).
Similarity
Belongs to the GADD45 family.
Mass
17.806 kDa
Sequence
MTLEELVACDNAAQKMQTVSAAVEELLVAAQLQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCENDIDIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDTWKSHGLVEVASYCEESRGNNQWVPYISLQER

Gene
GADD45B
Protein
Growth arrest and DNA damage-inducible protein GADD45 beta
Organism
Homo sapiens
Length
160 amino acids
Function
Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
Similarity
Belongs to the GADD45 family.
Mass
17.818 kDa
Sequence
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER

Gene
Gadd45b
Protein
Growth arrest and DNA damage-inducible protein GADD45 beta
Organism
Mus musculus
Length
160 amino acids
Function
Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK (By similarity).
Similarity
Belongs to the GADD45 family.
Mass
17.783 kDa
Sequence
MTLEELVASDNAVQKMQAVTAAVEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETLGTTEARDLHCLLVTNCHTDSWKSQGLVEVASYCEESRGNNQWVPYISLEER