GA20OX2

Gibberellin 20 oxidase 2

389 amino acids

Key oxidase enzyme in the biosynthesis of gibberellin that catalyzes the conversion of GA53 to GA20 via a three-step oxidation at C-20 of the GA skeleton (PubMed:12077303, PubMed:11961544, PubMed:30002253). Catalyzes the conversion of GA12 to GA9 via a three-step oxidation at C-20 of the GA skeleton (PubMed:30002253). Contributes to the promotion of internode elongation in response to submergence via ethylene and gibberellin signalings (PubMed:30002253).

Belongs to the iron/ascorbate-dependent oxidoreductase family. GA20OX subfamily.

42.513 kDa

MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPEPFVWPNGDARPASAAELDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHGVDAALARAALDGASDFFRLPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFGFHDRAAAPVVADYFSSTLGPDFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYYREFFADSSSIMRCNYYPPCPEPERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRPVSPVPGAMVINIGDTFMALSNGRYKSCLHRAVVNQRRERRSLAFFLCPREDRVVRPPPSAATPQHYPDFTWADLMRFTQRHYRADTRTLDAFTRWLAPPAADAAATAQVEAAS

GA20OX2

Gibberellin 20 oxidase 2

378 amino acids

Key oxidase enzyme in the biosynthesis of gibberellin that catalyzes the conversion of GA12 and GA53 to GA9 and GA20 respectively, via a three-step oxidation at C-20 of the GA skeleton. GA53 is less effectively oxidized than GA12, and GA25 is also formed as a minor product. Involved in the promotion of the floral transition, fertility and silique elongation, but plays only a minor role in elongation of seedling organs. Acts redundantly with GA20OX1.

Belongs to the iron/ascorbate-dependent oxidoreductase family. GA20OX subfamily.

42.937 kDa

MAILCTTTSPAEKEHEPKQDLEKDQTSPLIFNPSLLNLQSQIPNQFIWPDEEKPSIDIPELNVPFIDLSSQDSTLEAPRVIAEACTKHGFFLVVNHGVSESLIADAHRLMESFFDMPLAGKQKAQRKPGESCGYASSFTGRFSTKLPWKETLSFQFSNDNSGSRTVQDYFSDTLGQEFEQFGKVYQDYCEAMSSLSLKIMELLGLSLGVNRDYFRGFFEENDSIMRLNHYPPCQTPDLTLGTGPHCDPSSLTILHQDHVNGLQVFVDNQWQSIRPNPKAFVVNIGDTFMALSNGIFKSCLHRAVVNRESARKSMAFFLCPKKDKVVKPPSDILEKMKTRKYPDFTWSMFLEFTQKHYRADVNTLDSFSNWVITNNNPI