FSHB

Follitropin subunit beta

130 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.887 kDa

MMKSIQLCILLWCWRAICCHSCELTNITISIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNTQKVCTFKELVYETIRLPGCARHSDSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFSEMKE

Fshb

Follitropin subunit beta

130 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways (By similarity). Follitropin is involved in follicle development and spermatogenesis in reproductive organs (PubMed:9020850, PubMed:11416011).

Belongs to the glycoprotein hormones subunit beta family.

14.919 kDa

MMKLIQLCILFWCWRAICCHSCELTNITISVEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNTQKVCTFKELVYETVRLPGCARHSDSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFSEMKE

Fshb

Follitropin subunit beta

130 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.814 kDa

MMKSIQLCILLWCLRAVCCHSCELTNITISVEKEECRFCISINTTWCEGYCYTRDLVYKDPARPNTQKVCTFKELVYETIRLPGCARHSDSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.643 kDa

MKSVQLCFLFCCWRAICCKSCELTNITITVEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKICTFKELAYETVKVPGCAHQADSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFNEMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.609 kDa

MKTVQFCFLFCCWKAICCNSCELTNITIAIENEECHFCISINTTWCAGYCYTRDLVYKDPATPNIQTTCTFKELVYETVRVPGCAHHADSFYTYPVATQCHCGKCDSDSTDCTMQGLGPDYCSFSEMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.713 kDa

MKSVQFCFLFCCWRAICCRSCELTNITITVEKEECGFCISINTTWCAGYCYTRDLVYRDPARPNIQKTCTFKELVYETVKVPGCAHHADSLYTYPVATECHCSKCDSDSTDCTVRGLGPSYCSFREIKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.593 kDa

MKSVQFCFLFCCWRAICCRSCELTNITITVEKEECGFCISINTTWCAGYCYTRDLVYRDPARPNIQKTCTYKELVYETVKVPGCAHHADSLYTYPVATECQCGKCDGDSTDCTVRGLGPSYCSFSESRE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.688 kDa

MKSVQFCFLFCCWRAICCRSCELTNITITVEKEECSFCISINTTWCAGYCYTRDLVYKDPARPNIQKACTFKELVYETVKVPGCARHADSLYTYPVATECHCGKCDRDSTDCTVRGLGPSYCSFSDIRE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.694 kDa

MKSIQFCFFFCCWKAICCNGCELTNITITVEREECRFCISVNTTWCAGYCYTRDLVYRDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATECQCGKCDSDSTDCTVRGLGPSYCSFSEIKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.551 kDa

MKSVQFCFLFCCWRATCCRSCELTNITITVEKEECSFCISINTTWCAGYCYTRDLVYRDPARPNIQKTCTFKELVYETVRVPGCAHRADSLHTYPVATACHCGKCDSGSTDCTVRGLGPSYCSFSDIRE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.686 kDa

MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.387 kDa

MKSVQFCFLFCCWKAVCCNSCELTNITIAVEKEECGFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVKVPGCAHHADSLYTYPVATACHCGKCNSDSTDCTVRGLGPSYCSFGDMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways (PubMed:2494176, PubMed:24692546). Follitropin is involved in follicle development and spermatogenesis in reproductive organs (PubMed:407105, PubMed:8220432).

Belongs to the glycoprotein hormones subunit beta family.

14.7 kDa

MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways (PubMed:10612425). Follitropin is involved in follicle development and spermatogenesis in reproductive organs (By similarity).

Belongs to the glycoprotein hormones subunit beta family.

14.644 kDa

MKTVQFCFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKEVVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFSEMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.74 kDa

MKSVQLCLLLWCWRAICCRSCELTNITIAVEKEECRFCVSINTTWCAGYCYTRDLVYKDPARPNTQKVCTFKELVYETVRLPGCAHHSDSFYTYPVATECHCSKCDSHSTDCTVRGLGPSYCSFGEMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.737 kDa

MKTAQFYIFFFCWKAIWCNGCVLTNITISVEREECEFCISINTTWCSGYCHTRDLVYKEPIRPNIQKACTFREFVYETMSLPGCANQADSLYSYPVATACHCGSCDTDSTDCTVRGLGPSYCSFNERKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.655 kDa

MKSVQFCFLFCCWRVICCKSCELTNITITVEKEECRFCMSINATWCAGYCYTRDLVYKDPARPNNQKTCTFKELVYETVKVPGCAHQADSLYTYPVATECHCGKCDSDSTDCTVQGLGPSYCSFSEMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.66 kDa

MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGHCYTRDLVYKDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.605 kDa

MKSLQFCFLFCCWKAICCNSCELTNITITVEKEECNFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVKVPGCAHHADSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFSEMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.672 kDa

MKTVQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.588 kDa

MKSVQFCFLFCCWKAICCSSCELTNITIAVEKEECRFCISINTTWCSGYCYTRDLVYKDPARPNIQKICTFKELVYETVRVPGCAHHADSLYTYPVATECHCGNCDSDSTDCTVRGLGPSYCSFGEMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.529 kDa

MKTVQFCFLFCCWKAICCNSCELTNITIAIENEECHFCISINTTWCAGYCYTRDLVFKDPATPNIQTTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTTQGLGPDYCSFSEMKE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.669 kDa

MKSVQFCFLFCCWRAICCRSCELTNITITVEKEECSFCISINTTWCAGYCYTRDLVYKDPARPNIQKACTFKELVYETVKVPGCAHHADSLYTYPVATECHCGKCDRDSTDCTVRGLGPSYCSFSDIRE

FSHB

Follitropin subunit beta

129 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.704 kDa

MKTAQFYVLFFCWKAIWCNGCMLTNITISVEREECEFCISINTTWCSGYCHTRDLVYKDPIRPNVQKTCTFKEFVYETVNLPGCAKQADSLYSYPVATACHCGSCDTDSTDCTVRGLGPSYCSFNERKE

FSHB

Follitropin subunit beta

126 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

14.358 kDa

single

MKLIQLCILFWCWRAICCQGCELTNITIAVEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNTQKICTFKELVYETIRLPGCAHHSDSFYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFGE

fshb

Follitropin subunit beta

107 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

11.794 kDa

CELSNITIVLEKEECGACVSVNATWCSGYCYTKDANLMYPQKSEKQGVCTYTEVIYETVKIPGCAENVNPFYTYPVAVDCHCGRCDSETTDCTVRALGPTYCSLSQD

FSHB

Follitropin subunit beta

106 amino acids

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.

Belongs to the glycoprotein hormones subunit beta family.

11.947 kDa

CELTNITIAVEREECELCITVNATWCSGYCFTRDPVYKYPPVSEVQQTCTFKEVVYETVKIPGCRDHAESLYSYPVATECHCETCDTDSTDCTVRGLGPSYCSFNQ