FPGS

Folylpolyglutamate synthase, mitochondrial

587 amino acids

Catalyzes conversion of folates to polyglutamate derivatives allowing concentration of folate compounds in the cell and the intracellular retention of these cofactors, which are important substrates for most of the folate-dependent enzymes that are involved in one-carbon transfer reactions involved in purine, pyrimidine and amino acid synthesis.

Belongs to the folylpolyglutamate synthase family.

65.093 kDa

MSWARTHLRSALSLAAVSARGATTEGAARRWLSAWPAPQEPGMEYQDAVRMLNTLQTNASYLEQVKRQRSDPQAQLEAMEVYLARSGLQVEDLNQLNIIHVTGTKGKGSTCAFTERILRSYGLKTGFFSSPHLVQVRERIRINGKPISPELFTKHFWRLYHQLEEFKDDSHVAMPAYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLGMDHTSLLGDTVEKIAWQKGGIFKPGVPAFTVLQPEGPLAVLRDRAQQTSCPLYLCPPLEALEDGGLPLTLGLEGEHQRSNAALALQLAHCWLEQQDHQDIRELKVSRPSMRWQLPLAPVFHPTSHMRHGLRDTEWPGRTQVLRRGPLTWYLDGAHTTSSVQACVRWYCQSLQRSKHPSGGPEVYVLLFNSTGDRDSAALLKLLQPCQFDYAVFCPNLTEVSSTENADQQNFTVTLDQVLLRCLQHQQHWSCLSEKQASPDFLSSPSPEPGRPGSLQPALRPPHSTGTNSLVFSCISHALQWISQGRDPIFQAPSPPRSLLSHPTASSGASILREAGAIHVLVTGSLHLVGGVLKLLEPSLSQ

FPGS

Folylpolyglutamate synthase, mitochondrial

587 amino acids

Catalyzes conversion of folates to polyglutamate derivatives allowing concentration of folate compounds in the cell and the intracellular retention of these cofactors, which are important substrates for most of the folate-dependent enzymes that are involved in one-carbon transfer reactions involved in purine, pyrimidine and amino acid synthesis. Unsubstituted reduced folates are the preferred substrates. Metabolizes methotrexate (MTX) to polyglutamates.

Belongs to the folylpolyglutamate synthase family.

64.609 kDa

MSRARSHLRAALFLAAASARGITTQVAARRGLSAWPVPQEPSMEYQDAVRMLNTLQTNAGYLEQVKRQRGDPQTQLEAMELYLARSGLQVEDLDRLNIIHVTGTKGKGSTCAFTECILRSYGLKTGFFSSPHLVQVRERIRINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLGIDHTSLLGDTVEKIAWQKGGIFKQGVPAFTVLQPEGPLAVLRDRAQQISCPLYLCPMLEALEEGGPPLTLGLEGEHQRSNAALALQLAHCWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEWPGRTQVLRRGPLTWYLDGAHTASSAQACVRWFRQALQGRERPSGGPEVRVLLFNATGDRDPAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEEQASPDLWSAPSPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQWISQGRDPIFQPPSPPKGLLTHPVAHSGASILREAAAIHVLVTGSLHLVGGVLKLLEPALSQ

Fpgs

Folylpolyglutamate synthase, mitochondrial

587 amino acids

Catalyzes conversion of folates to polyglutamate derivatives allowing concentration of folate compounds in the cell and the intracellular retention of these cofactors, which are important substrates for most of the folate-dependent enzymes that are involved in one-carbon transfer reactions involved in purine, pyrimidine and amino acid synthesis. Dihydrofolate, tetrahydrofolate, 5,10-methylenetetrahydrofolate, 10-formyltetrahydrofolate and 5-formyltetrahydrofolate are the best substrates. Folic acid and 5-methyltetrahydrofolate can also act as substrates.

Belongs to the folylpolyglutamate synthase family.

64.955 kDa

MSWARSRLCSTLSLAAVSARGATTEGAARRGMSAWPAPQEPGMEYQDAVRTLNTLQTNASYLEQVKRQRSDPQAQLEAMEMYLARSGLQVEDLNRLNIIHVTGTKGKGSTCAFTERILRNYGLKTGFFSSPHMVQVRERIRINGKPISPELFTKHFWCLYNQLEEFKDDSHVSMPSYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAFDCTNIIRKPVVCGVSSLGIDHTSLLGDTVEKIAWQKGGIFKPGVPAFTVVQPEGPLAVLRDRAQQIGCPLYLCPPLEALEEVGLPLSLGLEGAHQRSNAALALQLAHCWLERQDHQDIQELKVSRPSIRWQLPLAPVFRPTPHMRRGLRDTVWPGRTQILQRGPLTWYLDGAHTTSSVQACVHWYRQSLERSKRTDGGSEVHILLFNSTGDRDSAALLKLLQPCQFDYAVFCPNVTEVSSIGNADQQNFTVTLDQVLLRCLQHQQHWNGLAEKQASSNLWSSCGPDPAGPGSLLLAPHPPQPTRTSSLVFSCISHALLWISQGRDPIFQPQSLPRNLLNHPTANSGASILREAAAIHVLVTGSLHLVGGVLKLLDPSMSQ

FPGS

Folylpolyglutamate synthase, mitochondrial

585 amino acids

Catalyzes conversion of folates to polyglutamate derivatives allowing concentration of folate compounds in the cell and the intracellular retention of these cofactors, which are important substrates for most of the folate-dependent enzymes that are involved in one-carbon transfer reactions involved in purine, pyrimidine and amino acid synthesis.

Belongs to the folylpolyglutamate synthase family.

64.9 kDa

MSRARCHALFLAAVSPRGATTRVAVRRGLSAWPVLQEPDMEYQDAVRTLNTLQTNANYLEMVKRKRGDPQTQLEAMKLYLARSGLQVEDLDQLNIIHITGTKGKGSTCAFTERILRSYGLKTGFFSSPHLVQVRERIRINGQPISSELFTKHFWRLYHRLEETKDDSSCVSMPGYFRFLTLMAFHVFLQEKVDLAVLEVGIGGAYDCTNIIRKPVVCGITSLGIDHTGLLGDTMEKIAWQKGGIFKSGVPAFTVLQPDEPLAVLRDRAQQISCPLYLCPPLQALEEGGPPLTLGLEGEHQRSNAALALQVARCWLQQKGYQDAGELKASRPSLPGQLPLAPVFQPTPRMQQGLRHTEWPGRTQLLRRGPLTWYLDGAHTTSSMQACVRWFRQALHRCERPDSGSEVRVLLFNSTGDRDSAALLKLLQPCQFDYAIFCPNLAEMASTDNADQQNFTVTLDQVLLRCLAHQQHWSRLHEEQVSPDPWSTPGQEQDGPASLLLAPHPPHTHSASSLVFSCISHALQWITQGRDPLFQPPSPPRGLLAHPVADSGATVLQEAADIHVLVTGSLHLVGGVLKLLEPSLSQ

fpgS

Folylpolyglutamate synthase

428 amino acids

Involved in the conversion of folates to polyglutamate derivatives, and likely functions in the retention of cellular folate pools. Catalyzes successive MgATP-dependent additions of glutamate to a pteroylmonoglutamate substrate, with a high preference for 5,10-methylenetetrahydrofolate (mTHF). Thus, metabolizes mTHF to the tetraglutamate derivative, but longer glutamate chain length products are not observed. Tetrahydrofolate (H4PteGlu) and 10-formyl-H4PteGlu are poorer folate substrates. In contrast to E.coli FolC, this enzyme does not display dihydrofolate synthase activity.

Belongs to the folylpolyglutamate synthase family.

46.589 kDa

MNYTETVAYIHSFPRLAKTGDHRRILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLQQQQADFNVTEFEFITALGYWYFRQRQVDVAVIEVGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKHKAGIIKRGIPVVTGNLVPDAAAVVAAKVATTGSQWLRFDRDFSVPKAKLHGWGQRFTYEDQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQLFSQPITVIAGILADKDYAAMADRLTAAFSTVYLVPVPGTPRALPEAGYEALHEGRLKDSWQEALAASLNDVPDQPIVITGSLYLASAVRQTLLGGKS