FATB

Palmitoyl-acyl carrier protein thioesterase, chloroplastic

412 amino acids

Plays an essential role in chain termination during de novo fatty acid synthesis. Possesses high thioesterase activity for palmitoyl-ACP versus other acyl-ACPs. Substrate preference is 16:0 > 18:1 > 18:0 > 16:1. Plays an essential role in the supply of saturated fatty acids necessary for plant growth and seed development. Contributes to 16:0 production particularly in flowers. May be involved in the synthesis of long chain fatty acid.

Belongs to the acyl-ACP thioesterase family.

45.687 kDa

MVATSATSSFFPVPSSSLDPNGKGNKIGSTNLAGLNSAPNSGRMKVKPNAQAPPKINGKKVGLPGSVDIVRTDTETSSHPAPRTFINQLPDWSMLLAAITTIFLAAEKQWMMLDWKPRRSDMLVDPFGIGRIVQDGLVFRQNFSIRSYEIGADRSASIETVMNHLQETALNHVKTAGLLGDGFGSTPEMFKKNLIWVVTRMQVVVDKYPTWGDVVEVDTWVSQSGKNGMRRDWLVRDCNTGETLTRASSVWVMMNKLTRRLSKIPEEVRGEIEPYFVNSDPVLAEDSRKLTKIDDKTADYVRSGLTPRWSDLDVNQHVNNVKYIGWILESAPVGIMERQKLKSMTLEYRRECGRDSVLQSLTAVTGCDIGNLATAGDVECQHLLRLQDGAEVVRGRTEWSSKTPTTTWGTAP

fatB

Ferric-anguibactin-binding protein FatB

322 amino acids

Involved in the uptake of iron in complex with the siderophore anguibactin. Binds ferric-anguibactin in the periplasm and mediates its transport into the cytoplasm.

Belongs to the bacterial solute-binding protein 8 family.

35.635 kDa

MFKSTLNIAVAIVCSSLVTLTGCEPKVAQSQVIQPLETPIVIEHNLGQTVISNRPQRVAALDMNEVDFLDQLNVPIAGMVKDFVPHFLEKYKNTPDISDLGAIVQPNMEKIYALKPDLVLMTPLHANQYEELSKLAPTVHFDIDFRNSHGHHVDIIKQHVIDLGEIFNKQTLAQKKVAEIDAKVDEVQALTAERSEKALVVMHNNGSFSSFGIESRYGFVFDVLGVKPASTEIAASLHGQPISSEFINQANPDILYIIDRTAVMEGKPVIDAEHLANPLLRQTKAWKNGKVIFVDADAWYITSASITSLKIVIDDIIKGYQS