FAS

Tumor necrosis factor receptor superfamily member 6

335 amino acids

Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro).

37.732 kDa

MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

FAS

Tumor necrosis factor receptor superfamily member 6

333 amino acids

Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both (By similarity).

37.468 kDa

MLGIWTLLPLVLTSVVRLLSKCVNAQVTDISSKGFELRKIVTTIETQNLEGLHHEGQFCRNPCPPGERKARDCTVNEDEPDCVPCQEGEEYTDKGHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSAVCEHCDPCTKCKHGIIEECTLTSNTKCKEEDSRSDLLWLCLLLLLLLIPPIVYVVIKEPCRKRRKENQGPHESTTLNPETAINLSDVDLSKYITTIAGAMTLSQVKDFVRKNGVSEAKIDEIKNDNVQDTAEQKVQLLRNWYQLHGKKDACDTLIKGLKTADLCTLAEKIHAVILKDITSDTENSNFGNEVQNLV

FAS

Tumor necrosis factor receptor superfamily member 6

332 amino acids

Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both (By similarity).

37.593 kDa

MSGIWVLLSLVFTCIAGPLSKGDDAQVTDPDSEMVKLNITKRESECPEGQHREGQFCCQPCPPGKRKHADCTSPGGAPQCVPCSEGEDYTDKNHHSSKCRRCRVCDGEHGLEVEKNCTRTQNTKCRCKPNFFCHTSQCEHCNPCTTCEHGVIENCTPTSNTKCREVFQSAGSRSNLHWLWALLILIPVPALVYREVKRRCRRKENGYQKPITSNAEEVPMIKDVDLGKYITRIAEQMKITEVKDFVRKNGIEETKIDEIMHDNPKDTAEQKVQLLRNWYLYHGKKDAYCTLIQGLRKAKLSALADKINDIVQKDVTSEQENANSQNENESLT

FAS

Tumor necrosis factor receptor superfamily member 6

331 amino acids

Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both (By similarity).

37.278 kDa

MLGIWTLLPLVLTSVVRLLSKCVNAQVTDINSKGFELRKIVTTIETRNLEGLHHEGQFCRNPCPPGERKARDCTVNEDEPDCVPCQEGKEYTDKGHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSAVCEHCDPCTKCKHGIIEECTLTSNTKCKEEDSRSDLLWLCLLLLLIPPIVYVVIKKACRKHRKENQGPHESTTLNPETAINLSDVDLSKYITTIAGGMTLSQVRDFVRKNGVSEAKIDEIKNDNVQDTAEQKVQLLRNWYQLHEKKDACDTLIKGLKTAGLCTLAEKIHAVILKDITSDTENSNFGNEVQNLV

FAS

Tumor necrosis factor receptor superfamily member 6

331 amino acids

Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both (By similarity).

37.266 kDa

MLGIWTLLPLVLTSVVRLLSKCVNAQVTDISSKGFELRKIVTTIETQNLEGLHHEGQFCRNPCPPGERKARDCTVNEDEPDCVPCQEGKEYTDKGHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSAVCEHCDPCTKCEHGIIEECTLTSNTKCKEEDSRSDLPWLCLLLLLIPPIVYVVIKKACRKHRKENQGPHESTTLNPETAINLSDVDLSKYITTIAGAMTLSQVKDFVRKNGVSEAKIDEIKNDNVQDTAEQKVQLLRNWYQLHGKKDACDTLIKGLKTADLCTLAEKIHAVILKDITSDTENSNFRNEIQSLV

FAS

Tumor necrosis factor receptor superfamily member 6

331 amino acids

Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both (By similarity).

37.255 kDa

MLGIWTLLPLVLTYVVRLLSKCVNAQVTDISSKGFELRKIVTTIETQNLEGLHHEGQFCRNPCPPGERKARDCTVNEDEPDCVPCQEGKEYTDKGHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSAVCEHCDPCTKCKHGIIEECTLTSNTKCKEEDSRSDLPWLCLLLLLIPPIVYVVIKKACRKHRKENQGPHESTTLNPETAINLSDVDLSKYITTIAGAMTLSQVKDFVRKNGVSEAKIDEIKNDNVQDTAEQKVQLLRNWYQLHGKKDACDTLIKGLKTADLCTLAEKIHAVILKDITSDTENSNFGNEVQNLV

Fas

Tumor necrosis factor receptor superfamily member 6

327 amino acids

Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both (By similarity).

37.437 kDa

MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE

Fas

Tumor necrosis factor receptor superfamily member 6

324 amino acids

Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both (By similarity).

36.835 kDa

MLWIMAVLPLVLAGPELNVRMQGTDSIFEGLELKRSVRETDNNCSEGLYQVGPFCCQPCQPGERKVKDCTTSGGAPTCHPCTEGEEYTDRKHYSDKCRRCAFCDEGHGLEVETNCTRTQNTKCRCKENFYCNASLCDHCYHCTSCGLEDILEPCTRTSNTKCKKQSSNYKLLWLLILPGLAILFVFIYKRYRKRQPGDPESGIPSPESVPMNVSDVNLNKYIWRTAEKMKICDAKKFARQHKIPESKIDEIEHNSPQDAAEQKIQLLQCWYQSHGKTGACQALIQGLRKANRCDIAEEIQAMVWEDHENSISNSRNENEGQSLE

FAS

Tumor necrosis factor receptor superfamily member 6

323 amino acids

Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both (By similarity).

36.445 kDa

MSGIWVHLSLIFISVSGPLSKGENAHMAGINSEGLKLNITEANSCQEGLYREHQFCCQPCPPGKRKNGDCKRDGDTPECVLCSEGNEYTDKSHHSDKCIRCSICDEEHGLEVEQNCTRTRNTKCRCKSNFFCNSSPCEHCNPCTTCEHGIIEKCTPTSNTKCKGSRSHANSLWALLILLIPIVLIIYKVVKSRERNKKNDYCNSAASNDEGRQLNLTDVDLGKYIPSIAEQMRITEVKEFVRKNGMEEAKIDDIMHDNVHETAEQKVQLLRNWYQSHGKKNAYCTLTKSLPKALAEKICDIVMKDITNERENANLQNENENLV