FABP7

Fatty acid-binding protein, brain

132 amino acids

FABP are thought to play a role in the intracellular transport of long chain fatty acids and their acyl-CoA esters. Binds oleic and palmitic acids but not palmitoyl CoA.

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

14.956 kDa

MVEAFCATWKLTESQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDRVVIRTQSTFKNTEISFHLGEEFDETTADDRNCKSVVSLDGDKLVHVQKWDGKETNFVREIKDGKMIMTLTFGDVVAVRHYEKA

FABP7

Fatty acid-binding protein, brain

132 amino acids

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

14.927 kDa

MVEAFCATWKLADSHNFDEYMKALGVGFAMRQVGNVTKPTVIISSEGDKVVIRTQSTFKNTEISFKLGEEFDETTPDDRNCKSVVTLDGDKLVHVQKWDGKETNFVREIKDGRMVMTLTFGDVVAVRHYEKA

FABP7

Fatty acid-binding protein, brain

132 amino acids

B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers (By similarity).

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

14.889 kDa

MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

Fabp7

Fatty acid-binding protein, brain

132 amino acids

B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers.

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

14.893 kDa

MVDAFCATWKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEINFQLGEEFEETSIDDRNCKSVVRLDGDKLIHVQKWDGKETNCTREIKDGKMVVTLTFGDIVAVRCYEKA

Fabp7

Fatty acid-binding protein, brain

132 amino acids

B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers.

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

14.864 kDa

MVDAFCATWKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEISFQLGEEFEETSIDDRNCKSVIRLDGDKLIHVQKWDGKETNCVREIKDGKMVVTLTFGDVVAVRCYEKA