FABP2

Fatty acid-binding protein homolog 2

133 amino acids

May play a role in the acquisition, storage, and transport of lipids, and may be important to the organism since it is incapable of synthesizing most of its lipids de novo.

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

15.409 kDa

MEPFIGTWKMEKSEGFDKIMERLGVDYFTRKMGNMMKPNLIISDLGDGRYNMRSESKFKTSEFSFKLGEQFKEVTPDSREVMSMLTVEDGVLKQEQVGKDKTTYIDRVVYGNELRATVKADELVCVRTYSRGM

FABP2

Fatty acid-binding protein, intestinal

132 amino acids

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor (By similarity).

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

15.036 kDa

MAFDGTWKVDRNENYEKFMEKMGINVVKRKLAAHDNLKLIITQEGNKFTVKESSTFRSIEIIFELGVTFNYSLADGTELSGAWALEGDKLVGKFKRLDNGNALNTVREIIGGEMVQTYTYEGVEAKRIFKKE

FABP2

Fatty acid-binding protein, intestinal

132 amino acids

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

15.207 kDa

MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Fabp2

Fatty acid-binding protein, intestinal

132 amino acids

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

15.126 kDa

MAFDGTWKVDRNENYEKFMEKMGINVMKRKLGAHDNLKLTITQDGNKFTVKESSNFRNIDVVFELGVNFPYSLADGTELTGAWTIEGNKLIGKFTRVDNGKELIAVREVSGNELIQTYTYEGVEAKRFFKKE

FABP2

Fatty acid-binding protein, intestinal

132 amino acids

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor (By similarity).

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

15.217 kDa

MAFDGAWKIDRNENYDKFMEKMGINVVKRKLAAHDNLKLIITQEGNKFTVKESSTFRNIEIVFELGVTFNYSLADGTELTGNWNLEGNKLVGKFQRVDNGKELNTVREIIGDEMVQTYVYEGVEAKRIFKKN

Fabp2

Fatty acid-binding protein, intestinal

132 amino acids

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor (By similarity).

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

15.124 kDa

MAFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

fabp2

Fatty acid-binding protein, intestinal

132 amino acids

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

15.252 kDa

MAFDGTWKVDRSENYEKFMEVMGVNIVKRKLGAHDNLKVIIQQDGNNFTVKESSTFRNIEIKFTLAQPFEYSLADGTELNGAWFLQDNQLLGTFTRKDNGKVLQTTRQIIGDELVQTYEYEGTESKRIFKRG

fabp2

Fatty acid-binding protein, intestinal

33 amino acids

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

3.66 kDa

multiple

YQLESQEGFVPFSVSEIEQRVTVTTGSKTVVTL