ercc1

DNA excision repair protein ERCC-1

514 amino acids

Structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair.

Belongs to the ERCC1/RAD10/SWI10 family.

56.615 kDa

MSSQQTDNNPIPTTTTNNNTNNDNDIASTNNNTNNDDDSTTTNTSTNKPRKRFVIPSASQALKKSDLSMVEINSKLKQAEENAKQAEDLQKSNAIILTPKSTTTMTTTTTPVQQRMPIPSILAKRNVNTTTTTSTSPLSTSPPISSPLQTPYYSPSFVKNPTSPAPINKPIGPSLPMRPSLPKKPAAYSTTLSTYSSSSSSYSSSTTTQNYQHIDKIYANSKQRGSLMMNSFSKNIIIEYSELQYPDFILNSNTLVFYLPSLKTHRDNPNLIQDRIKGLSTLMTNSDSFTLRILLVFADLSDSDNCEQFINELNLIAIKLQFTLIVCWSQIEAAKYLEAYKTFNNRAPDPIKARAQPIELGGKSKNEQVLTSIKSVNKTDATTLLKNFQTMQQIFTCQKTTLSKLPGFGPVKVQKFYNTINQPFKTKPSTKTTTTTTTTTTTTTSANISSNNNNNNINTNDGNNNNNTINNINFNNDENEVDQDPLNFSFDFGGNGNGDGDSDGDGESENQINT

ERCC1

DNA excision repair protein ERCC-1

410 amino acids

Seems to be involved in nucleotide excision repair (NER) of damaged DNA (dark repair mechanism). The UVH1/RAD1-ERCC1/RAD10 complex may act as an endonuclease making DNA incision 5' to the lesion site. In vitro, is implicated in double strand breaks (DSBs) repair and is required for homologous recombination in the presence of non-homologous overhangs. In vitro, is involved in chromosomal recombination between tandem repeats in both direct and inverted orientations. May mediate the induction of a DNA-damage sensitive cell-cycle checkpoint during the G2 phase.

Belongs to the ERCC1/RAD10/SWI10 family.

45.748 kDa

MANEDDDGEKSRSLHQQIARKPKTQIVIGVPSYQEVLESSQTKSTPPSLFKPSQSFSQAFAFVKSSDVYSPPPPSSAAASSSQPSGASQVPHSSSQTHQTDGASSSSTPVATGSVPSNTTQNRNAILVSHRQKGNPLLKHIRNVKWVFSDIIPDYVLGQNSCALYLSLRYHLLHPDYLYFRIRELQKNFKLSVVLCHVDVEDTVKPLLEVTKTALLHDCTLLCAWSMTECARYLETIKVYENKPADLIQGQMDTDYLSRLNHSLTSIRHVNKSDVVTLGSTFGSLAHIIDASMEDLARCPGIGERKVKRLYDTFHEPFKRATSSYPSVVEPPIPEAPVEKDVNSEEPVEEDEDFVEDSRKRKKKEPEPEKTVKTALSAVFARYSDRLSKKKEKQKEKDTTTASDAETHQN

Ercc1

DNA excision repair protein ERCC-1

298 amino acids

Non-catalytic component of a structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair. Responsible, in conjunction with SLX4, for the first step in the repair of interstrand cross-links (ICL). Participates in the processing of anaphase bridge-generating DNA structures, which consist in incompletely processed DNA lesions arising during S or G2 phase, and can result in cytokinesis failure. Also required for homology-directed repair (HDR) of DNA double-strand breaks, in conjunction with SLX4 (By similarity).

Belongs to the ERCC1/RAD10/SWI10 family.

32.91 kDa

MDPGKDEESRPQPSGPPTRRKFVIPLEEEEVPCAGVKPLFRSSRNPTIPATSAHVAPQTYAEYAITQPPGGAGATVPTGSEPAAGENPSQTLKTGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGEVIPDYVLGQSTCALFLSLRYHNLHPDYIHERLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLVLAWSAEEAGRYLETYKAYEQKPADLLMEKLEQNFLSRATECLTTVKSVNKTDSQTLLATFGSLEQLFTASREDLALCPGLGPQKARRLFEVLHEPFLKVPR

ERCC1

DNA excision repair protein ERCC-1

297 amino acids

Isoform 1: Non-catalytic component of a structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair. Responsible, in conjunction with SLX4, for the first step in the repair of interstrand cross-links (ICL). Participates in the processing of anaphase bridge-generating DNA structures, which consist in incompletely processed DNA lesions arising during S or G2 phase, and can result in cytokinesis failure. Also required for homology-directed repair (HDR) of DNA double-strand breaks, in conjunction with SLX4.

Belongs to the ERCC1/RAD10/SWI10 family.

32.562 kDa

MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP

ERCC1

DNA excision repair protein ERCC-1

294 amino acids

Non-catalytic component of a structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair. Responsible, in conjunction with SLX4, for the first step in the repair of interstrand cross-links (ICL). Participates in the processing of anaphase bridge-generating DNA structures, which consist in incompletely processed DNA lesions arising during S or G2 phase, and can result in cytokinesis failure. Also required for homology-directed repair (HDR) of DNA double-strand breaks, in conjunction with SLX4 (By similarity).

Belongs to the ERCC1/RAD10/SWI10 family.

32.544 kDa

MDEEGVHKPAGPPTRKKFLIPTDEDVVPPPGAKPLFRSTRSLPTVETSPPPGPQTYAEYALSGPPGGAEATRPVGPEPLAEETPNQAPKPGAKSNSIIVSPRQRGNPVLRFVRNVPWEFGDVLPDYVLGQSTCALFLSLRYHNLHPDYIHQRLQSLGKSYALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLSLCPGLGPQKARRLFDVFHEPFLKVPH