ENTR1

Endosome-associated-trafficking regulator 1

435 amino acids

Endosome-associated protein that plays a role in membrane receptor sorting, cytokinesis and ciliogenesis (PubMed:23108400, PubMed:25278552, PubMed:27767179). Involved in the endosome-to-plasma membrane trafficking and recycling of SNX27-retromer-dependent cargo proteins, such as GLUT1 (PubMed:25278552). Involved in the regulation of cytokinesis; the function may involve PTPN13 and GIT1 (PubMed:23108400). Plays a role in the formation of cilia (PubMed:27767179). Involved in cargo protein localization, such as PKD2, at primary cilia (PubMed:27767179). Involved in the presentation of the tumor necrosis factor (TNF) receptor TNFRSF1A on the cell surface, and hence in the modulation of the TNF-induced apoptosis (By similarity).

Belongs to the ENTR1 family.

47.961 kDa

MSGYQRRPGATPLSRARSLAIPDAPAFYERRSCLPQLNCERPHGRDLDSPFFGIRPAFMCYVPSPVLASVGDTDFGYGKGKCSKQSPSGAHGTHFGDDRFEDLEEANPFSFREFLKTKNLGLSKEDPASRIYAKEASRHSLGLDHNSPPSQTGGYGLEYQQPFFEDPTGAGDLLDEEEDEDTGWSGAYLPSAIEQTHPERVPAGTSPCSTYLSFFSTPSELAGPESLPSWALSDTDSRVSPASPAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSEAQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVSNFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILKSIDRISEVKDEEEDS

Entr1

Endosome-associated-trafficking regulator 1

432 amino acids

Endosome-associated protein that plays a role in membrane receptor sorting, cytokinesis and ciliogenesis. Involved in the endosome-to-plasma membrane trafficking and recycling of SNX27-retromer-dependent cargo proteins, such as GLUT1. Involved in the regulation of cytokinesis; the function may involve PTPN13 and GIT1. Plays a role in the formation of cilia. Involved in cargo protein localization, such as PKD2, at primary cilia (By similarity). Involved in the presentation of the tumor necrosis factor (TNF) receptor TNFRSF1A on the cell surface, and hence in the modulation of the TNF-induced apoptosis (PubMed:16332174).

Belongs to the ENTR1 family.

48.025 kDa

MSGYARRQGAPPLSRTRSLVVPDAPAFYERRSCLPQLDCERPHGGDLHPHLFGFRPTFMCYVPSPVLASVGDTGFGYGKGKCTNQGPSGAPETRFGGDKLEDLEEANPFSFKEFLKTKNLSLSKEDTTTSRIYPKEASRHPLGLEHSSPASQLMGYGLESQQPFFEDPTRASNLEEDEDDGWNITYLPSAVDQTHSSRDTQDSPPCDTYLSFFSNSSELACPESLPPWTLSDTDSRISPASPAGSPNADFAAHEESLGDRHLRTLQISYEALKDENSKLRRKLNEVQSFSETQTEMVRTLERKLEAKMIKEESDFHDLESVVQQVEQNLELMTKRAVKAENHVLKLKQEINLLQAQLSNLRRENEALRSGQGASLSVVKQNTDVALQNLHLVMNSAHASIKQLVSGADTLNLVAEILKSIDRISEVKDEVDS

ENTR1

Endosome-associated-trafficking regulator 1

359 amino acids

Endosome-associated protein that plays a role in membrane receptor sorting, cytokinesis and ciliogenesis. Involved in the endosome-to-plasma membrane trafficking and recycling of SNX27-retromer-dependent cargo proteins, such as GLUT1. Involved in the regulation of cytokinesis; the function may involve PTPN13 and GIT1. Plays a role in the formation of cilia. Involved in cargo protein localization, such as PKD2, at primary cilia (By similarity). Involved in the presentation of the tumor necrosis factor (TNF) receptor TNFRSF1A on the cell surface, and hence in the modulation of the TNF-induced apoptosis (By similarity).

Belongs to the ENTR1 family.

39.871 kDa

MAGYARRPGVTPLSRARSLVIPDDDKLGDLEAANPFSFKEFLKTKNLSLSKEDTDSRVYSQEATRHSLGLDRTSPASQTVGYGLEYQQPFFEDPTGAGDLLDEDEDEEDGWNGAYLPSAMEQTHSSRVAASTSPCSTYVSFFSNPSELVGPESLPPWTLSDSDSRISPTGSPSADFTAHGESLGDRHLRTLQISYEALKDENSKLRRKLTEIQSFSETQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVLKLRQEVSLLQAQVSDFKRENEALRSGQGASLTVVKQNTDVALQNLRVVMNNAHASIKQLVSGAETLNLVAEILKSIDRISEIKDQGEES

entr1

Endosome-associated-trafficking regulator 1

346 amino acids

Endosome-associated protein that plays a role in membrane receptor sorting, cytokinesis and ciliogenesis.

Belongs to the ENTR1 family.

38.301 kDa

MSGSSKQPHAKGKTLIIEDDCEAEALDEANPFSFKEFVKSQTFPGFVSSNSKRAFSKDSNQSTTQFRGPSECPDGNLEFQETYFRDPTLYDDLQEDEDDDWSGSYHPSVIENTHGPKVPSPAGTDGDESYGYGASDMSGDGLITGWQQAVLPSPPAGLHGKTQHRPDSTSDSEEGLRLLQINCEELQEENLHLKSKICKLKELNDSQNEKVRQLERKLEERILEEQKEAQDLESMVQQVEKNLQMMTKRAAKAEGNVTKLKQEMALLQIELTTYKAENEALRRGETAGMNAVKQNSNLALENLQKVVSGAQSSIKQLVAGAEALTLVAELLRSIDKIAEIHNDGVP

entr1

Endosome-associated-trafficking regulator 1

311 amino acids

Endosome-associated protein that plays a role in membrane receptor sorting, cytokinesis and ciliogenesis.

Belongs to the ENTR1 family.

35.359 kDa

MSRHKSKKLIIEDDEPKQDELNPFSFKEFIRNKNQPSCSTEATEVYNGACLVEQDYNTSIDFATKGPFFTDPSALCQPPESEPDETWIESHQRSAIEGSPDFELCGASDISAYSEQSSLCSDEREAAEWELGQSDFLPKKHLSRISTGSYEGDEETSVIDISFHHKRGNAENGTKNLQQLREENSLLRKQVKELVRMSETDSRRIKQLTDEMHNKKLQEEKEANDLEAMVQSVEQNLQLMTKRAVKAENNISKLKQEMLKLQGQLEDYKSENERLRLGETAALATMRHNAQVASEYLNKAAQDAEISINSC