ELF4

ETS-related transcription factor Elf-4

663 amino acids

Transcriptional activator that binds to DNA sequences containing the consensus 5'-WGGA-3'. Transactivates promoters of the hematopoietic growth factor genes CSF2, IL3, IL8, and of the bovine lysozyme gene. Acts synergistically with RUNX1 to transactivate the IL3 promoter (By similarity). Also transactivates the PRF1 promoter in natural killer (NK) cells. Plays a role in the development and function of NK and NK T-cells and in innate immunity. Controls the proliferation and homing of CD8+ T-cells via the Kruppel-like factors KLF4 and KLF2 (By similarity). Controls cell senescence in a p53-dependent manner. Can also promote cellular transformation through inhibition of the p16 pathway.

Belongs to the ETS family.

70.73 kDa

MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYSGLELDDVHNGIITDGTLCMTQDQILEGSFLLTDDNEATSHTMSTAEVLLNMESPSDILDEKQIFSTSEMLPDSDPAPAVTLPNYLFPASEPDALNRAGDTSDQEGHSLEEKASREESAKKTGKSKKRIRKTKGNRSTSPVTDPSIPIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLVVIEDEDESSEATAAPPQASTASVASASTTRRTSSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVAPVGSGSALTLQTIPLTTVLTNGPPASTTAPTQLVLQSVPAASTFKDTFTLQASFPLNASFQDSQVAAPGAPLILSGLPQLLAGANRPTNPAPPTVTGAGPAGPSSQPPGTVIAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPVAELELSSGSGSLLMAEPSVTTSGSLLTRSPTPAPFSPFNPTSLIKMEPHDI

Elf4

ETS-related transcription factor Elf-4

655 amino acids

Transcriptional activator that binds to DNA sequences containing the consensus 5'-WGGA-3'. Transactivates promoters of the hematopoietic growth factor genes CSF2, IL3, IL8, and of LYZ. Acts synergistically with RUNX1 to transactivate the IL3 promoter (By similarity). Also transactivates the PRF1 promoter in natural killer (NK) cells. Plays a role in the development and function of NK and NK T-cells and in innate immunity. Controls the proliferation and homing of CD8+ T-cells via the Kruppel-like factors KLF4 and KLF2. Controls cell senescence in a p53-dependent manner. Can also promote cellular transformation through inhibition of the p16 pathway.

Belongs to the ETS family.

70.8 kDa

MAIALQPSDLVFEFASNGMDDIHQLEDPSVFPAVIVEQVPYPELVHLCSGLDLDEVHNGIIRDRTLCMTQDQILEGSILLTDDDVSTSNNVSSTEVLFNVATPSDVLDEKQIFSSPEVLSDSNSVQAINLPNFLLSTPEPDDLKKTSDAGDQKEHSEEEKVSREENLRKMGKARKRNRKTKNNRSTSPVTDPSMPIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLVVIDDEEESPETPEDSSQASTSSTPSTSTIRRASSRVGTRASPEDKDNPPWEKPKVQHTGLQPSASLELGLSVDEEVPTTSTMLASPLQSQARLTKTVSSSPAPSNIHLGVAPVGPGSTVTLQTIPLTTVLTNGPPASTTAPTQLVLQSVPQVSTFKDTFTLQTSFPLNTNLQENQVATQGAPLILSGLPQLLAGANPQSNPAPSQVIGAGSAGPSSQPPGTVIAAFIRTSSGTSVPVVKEGPLRSSSYVQGVVTGAPVEGLLVPEETLRELLRDQGHLQPLPSQVLSRGSHNLSLVGNQTLSPPSHPTVGLTPVAELELSSGSGPLFVTEPSVTRSPTQAPFSPFNPTSLIKMEPQDI

ELF4

Protein EARLY FLOWERING 4

111 amino acids

Component of the central CCA1/LHY-TOC1 feedback loop in the circadian clock that promotes clock accuracy and is required for sustained rhythms in the absence of daily light/dark cycles. Part of a corepressor complex consisting of ELF4, ELF3, and LUX involved in the transcriptional regulation of APRR9. Increases ELF3 nuclear distribution and localization in nuclear bodies. Required for responsiveness to continuous red, by regulating phytochrome B (phyB) signaling (including during seedling de-etiolation) and gene expression. Mediates both entrainment to an environmental cycle and circadian rhythm sustainability under constant conditions. Controls flowering time. Necessary for light-induced expression of both CCA1 and LHY.

Belongs to the EARLY FLOWERING 4 family.

12.376 kDa

MKRNGETKRRRNVAEEAEQGEDPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALIQELNGNISKVVNMYSDLNTSFSSGFHGGKNGHDGGGAAGTRA