EID1

Phytochrome A-associated F-box protein

336 amino acids

Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Negative regulator of the phyA signaling pathway that shifts the responsiveness of the phyA signaling system associated with hypocotyl elongation from red to far-red wavelength.

37.398 kDa

MAESVFSCIPEDVVFNIFFKLQDDPRNWARLACVCTKFSSIVRNVCCKTQCYSAIPTVISDLLPLPPSAAASASSSTAADSSLTPPGGWASLYKLAVCCPGLFHAGILLENSDFGLERELGPDQNLDPKPTTTDLALNDEEVSKPVGSGLETTSFWSLYDDLYTDTIPAPPPEDSIDDQEEEIETSEIRPGRDLPVRKRRKICRSLGSHLASGGWNLSREQGNKLLASRFRGDCLYICNWPGCIHVEEKRNYMLFRGVFKDFKRSRVWRTINDGNRSKTSGLKCAFCLCDETWDLHSSFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTALPLYT

EID1

EP300-interacting inhibitor of differentiation 1

188 amino acids

Interacts with RB1 and EP300 and acts as a repressor of MYOD1 transactivation. Inhibits EP300 and CBP histone acetyltransferase activity. May be involved in coupling cell cycle exit to the transcriptional activation of genes required for cellular differentiation. May act as a candidate coinhibitory factor for NR0B2 that can be directly linked to transcription inhibitory mechanisms (By similarity).

20.973 kDa

MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRNGAQPQLEEEGPMEEEEAQPMAAPEGKRSLASGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE

EID1

EP300-interacting inhibitor of differentiation 1

187 amino acids

Interacts with RB1 and EP300 and acts as a repressor of MYOD1 transactivation. Inhibits EP300 and CBP histone acetyltransferase activity. May be involved in coupling cell cycle exit to the transcriptional activation of genes required for cellular differentiation. May act as a candidate coinhibitory factor for NR0B2 that can be directly linked to transcription inhibitory mechanisms.

20.876 kDa

MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE

Eid1

EP300-interacting inhibitor of differentiation 1

169 amino acids

Interacts with RB1 and EP300 and acts as a repressor of MYOD1 transactivation. Inhibits EP300 and CBP histone acetyltransferase activity. May be involved in coupling cell cycle exit to the transcriptional activation of genes required for cellular differentiation. May act as a candidate coinhibitory factor for NR0B2 that can be directly linked to transcription inhibitory mechanisms.

18.921 kDa

MAEMAELCELYEESNELQMDVLPGEGYMEVGRGARGPAPEEGPMEEEAGPAAARAQRGLFPEAGADLEGDEFDDWEDDYEFPEEERWSGAMHRVSAALEEANKVFLRTARAGDALDGGFQARCEKSPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRELMLTREEETT