Efcab9

EF-hand calcium-binding domain-containing protein 9

216 amino acids

pH-dependent Ca(2+) sensor required to activate the CatSper channel, a complex involved in sperm cell hyperactivation (PubMed:31056283). Sperm cell hyperactivation is needed for sperm motility which is essential late in the preparation of sperm for fertilization (PubMed:31056283). Associates with the CatSper complex via direct interaction with CATSPERZ, and senses intracellular Ca(2+) (PubMed:31056283). Together with CATSPERZ, associates with the CatSper channel pore and is required for the two-row structure of each single CatSper channel (PubMed:31056283).

26.125 kDa

MKLTPGCFLWYLYMDKIYCLLSLRNVKALMVYFHLLDVHHRNTLNDVLFFHFLQHVTNLNKSQIGMIFDLLDWTAVGEIGFDQFYVLICILLAHQDHLEDHFMYRHSRPVFELLDLDGEMNIGAANFQNYRFLFNIKKQELRDLFHDFDITGDRLLNYKEFKLYTIFCTDKSIDRKKRRKDREAAREREKEKGKDKEKYLHLKKIYSSMLSHRSIL

EFCAB9

EF-hand calcium-binding domain-containing protein 9

197 amino acids

pH-dependent Ca(2+) sensor required to activate the CatSper channel, a complex involved in sperm cell hyperactivation. Sperm cell hyperactivation is needed for sperm motility which is essential late in the preparation of sperm for fertilization. Associates with the CatSper complex via direct interaction with CATSPERZ, and senses intracellular Ca(2+). Together with CATSPERZ, associates with the CatSper channel pore and is required for the two-row structure of each single CatSper channel.

23.937 kDa

MRLKQGSFLWYLYLDKIYCLLSVRNVKALAEYFHILDVHGKNTLNDVLFYHFLHHVTDLKKAQINIVFDMLDWNAVGEIDFEKFYMLVCMLLAHQNHLEGQFMYRHSRPVFDLLDLKGDLRIGAKNFEMYRFLFNIQKQELKDLFRDFDITGDNRLNYQEFKLYTIIYTDKLQKRQKTEEKEKGERKRSLYSKCHIK