Protein
Transcription factor E2F2
Organism
Drosophila melanogaster
Function
Transcriptional repressor that binds to E2f sites and represses E2f-regulated target genes. Binding to E2f sites requires transcription factor Dp. Acts synergistically with Rbf2 to antagonize E2f1-mediated transcriptional activation. Component of the DREAM complex, a multiprotein complex that can both act as a transcription activator or repressor depending on the context. The DREAM complex is required for recruiting E2f2 at differentiation-specific promoters and for stabilizing E2f2-Rbf complexes during S phase. During development, the complex represses transcription of developmentally controlled E2f target genes. During oogenesis, plays a role in restricting DNA synthesis to sites of chorion gene amplification in late stage ovarian follicle cells. Plays an inhibitory role in ionizing radiation (IR)-induced p53-independent apoptosis. May be involved in cell cycle exit by temporarily limiting CycE-dependent activation of E2f-regulated transcription.
Similarity
Belongs to the E2F/DP family.
Sequence
MYKRKTASIVKRDSSAAGTTSSAMMMKVDSAETSVRSQSYESTPVSMDTSPDPPTPIKSPSNSQSQSQPGQQRSVGSLVLLTQKFVDLVKANEGSIDLKAATKILDVQKRRIYDITNVLEGIGLIDKGRHCSLVRWRGGGFNNAKDQENYDLARSRTNHLKMLEDDLDRQLEYAQRNLRYVMQDPSNRSYAYVTRDDLLDIFGDDSVFTIPNYDEEVDIKRNHYELAVSLDNGSAIDIRLVTNQGKSTTNPHDVDGFFDYHRLDTPSPSTSSHSSEDGNAPACAGNVITDEHGYSCNPGMKDEMKLLENELTAKIIFQNYLSGHSLRRFYPDDPNLENPPLLQLNPPQEDFNFALKSDEGICELFDVQCS