About Products Protein Database Contact

Dred_2550

Gene
Dred_2550
Protein
dTTP/UTP pyrophosphatase
Organism
Desulfotomaculum reducens (strain MI-1)
Length
191 amino acids
Function
Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids.
Similarity
Belongs to the Maf family. YhdE subfamily.
Mass
20.695 kDa
Sequence
MRPIILASASPRRQELLKNLGLEFEVQVSDVDENLEENISSGQLVEKLAERKAAAVALIRTQGLVIGADTIVVLGDKPLGKPTNREEAVQMLSNLQGKSHEVFTGLAVIDASTGQRVVTHQVTEVNFKTLTKDQIERYVDTGEPMDKAGGYAVQGLASIFIDSIRGCYFSVVGLPISKLADALRMFGVEIV