About Products Protein Database Contact

Dhaf_3052

Gene
Dhaf_3052
Protein
UPF0316 protein Dhaf_3052
Organism
Desulfitobacterium hafniense (strain DCB-2 / DSM 10664)
Length
174 amino acids
Similarity
Belongs to the UPF0316 family.
Mass
19.624 kDa
Sequence
MGSILQFVLIIITINITYVTLTTIRFILMIKGMRVYASLLSVLEVFIYIMGLSIILDNLDSYWNIAAYCCGYGVGVYLGSRIEERLALGYIMAQVIVECEYQGLAGELRDAGFGVTSWLGEGKTGPRMVMMVLAKRNRQKELLNRIDSLCSNAFVIFEEPKNFRGGFWAKKVLH