DTL

Denticleless protein homolog

730 amino acids

Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control, DNA damage response and translesion DNA synthesis. The DCX(DTL) complex, also named CRL4(CDT2) complex, mediates the polyubiquitination and subsequent degradation of CDT1, CDKN1A/p21(CIP1), FBH1, KMT5A and SDE2 (PubMed:16861906, PubMed:16949367, PubMed:16964240, PubMed:17085480, PubMed:18703516, PubMed:18794347, PubMed:18794348, PubMed:19332548, PubMed:20129063, PubMed:23478441, PubMed:23478445, PubMed:23677613, PubMed:27906959). CDT1 degradation in response to DNA damage is necessary to ensure proper cell cycle regulation of DNA replication (PubMed:16861906, PubMed:16949367, PubMed:17085480). CDKN1A/p21(CIP1) degradation during S phase or following UV irradiation is essential to control replication licensing (PubMed:18794348, PubMed:19332548). KMT5A degradation is also important for a proper regulation of mechanisms such as TGF-beta signaling, cell cycle progression, DNA repair and cell migration (PubMed:23478445). Most substrates require their interaction with PCNA for their polyubiquitination: substrates interact with PCNA via their PIP-box, and those containing the 'K+4' motif in the PIP box, recruit the DCX(DTL) complex, leading to their degradation. In undamaged proliferating cells, the DCX(DTL) complex also promotes the 'Lys-164' monoubiquitination of PCNA, thereby being involved in PCNA-dependent translesion DNA synthesis (PubMed:20129063, PubMed:23478441, PubMed:23478445, PubMed:23677613). The DDB1-CUL4A-DTL E3 ligase complex regulates the circadian clock function by mediating the ubiquitination and degradation of CRY1 (PubMed:26431207).

Belongs to the WD repeat cdt2 family.

79.468 kDa

MLFNSVLRQPQLGVLRNGWSSQYPLQSLLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSAPNMEHVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVKAGELIGTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMVWDTRCNKKDGFYRQVNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILDSTGSTLFANCTDDNIYMFNMTGLKTSPVAIFNGHQNSTFYVKSSLSPDDQFLVSGSSDEAAYIWKVSTPWQPPTVLLGHSQEVTSVCWCPSDFTKIATCSDDNTLKIWRLNRGLEEKPGGDKLSTVGWASQKKKESRPGLVTVTSSQSTPAKAPRAKCNPSNSSPSSAACAPSCAGDLPLPSNTPTFSIKTSPAKARSPINRRGSVSSVSPKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQAEACSESRNRVKRRLDSSCLESVKQKCVKSCNCVTELDGQVENLHLDLCCLAGNQEDLSKDSLGPTKSSKIEGAGTSISEPPSPISPYASESCGTLPLPLRPCGEGSEMVGKENSSPENKNWLLAMAAKRKAENPSPRSPSSQTPNSRRQSGKKLPSPVTITPSSMRKICTYFHRKSQEDFCGPEHSTEL

Dtl

Denticleless protein homolog

729 amino acids

Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control, DNA damage response and translesion DNA synthesis. The DCX(DTL) complex, also named CRL4(CDT2) complex, mediates the polyubiquitination and subsequent degradation of CDT1, CDKN1A/p21(CIP1), FBH1, KMT5A and SDE2. CDT1 degradation in response to DNA damage is necessary to ensure proper cell cycle regulation of DNA replication. CDKN1A/p21(CIP1) degradation during S phase or following UV irradiation is essential to control replication licensing. KMT5A degradation is also important for a proper regulation of mechanisms such as TGF-beta signaling, cell cycle progression, DNA repair and cell migration. Most substrates require their interaction with PCNA for their polyubiquitination: substrates interact with PCNA via their PIP-box, and those containing the 'K+4' motif in the PIP box, recruit the DCX(DTL) complex, leading to their degradation. In undamaged proliferating cells, the DCX(DTL) complex also promotes the 'Lys-164' monoubiquitination of PCNA, thereby being involved in PCNA-dependent translesion DNA synthesis. The DDB1-CUL4A-DTL E3 ligase complex regulates the circadian clock function by mediating the ubiquitination and degradation of CRY1 (By similarity).

Belongs to the WD repeat cdt2 family.

79.131 kDa

MLFNSVLRQPQLGVLRNGWSSHYPLQSLLSGYQCNCNDEHTSYGETGVPVPPFGCTFCTAPSMEHILAVANEEGFVRLYNTESQTSKKTCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVRAGELMGTCKGHQCSLKSVAFPKFQKAVFSTGGRDGNIMIWDTRCNKKDGFYRQVNQISGAHNTADKQTPSKPKKKQNSKGLAPAVDSQQSVTVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGTSTRKLGYSSLVLDSTGSTLFANCTDDNIYMFNMTGLKTSPVAVFNGHQNSTFYVKSSLSPDDQFLISGSSDEAAYIWKVSMPWHPPTVLLGHSQEVTSVCWCPSDFTKIATCSDDNTLKIWRLNRGLEEKPGDKHSIVGWTSQKKKEVKACPVTVPSSQSTPAKAPRAKSSPSISSPSSAACTPSCAGDLPLPSSTPTFSVKTTPATTRSSVSRRGSISSVSPKPLSSFKMSLRNWVTRTPSSSPPVTPPASETKISSPRKALIPVSQKSSQADACSESRNRVKRRLDSSCLESVKQKCVKSCNCVTELDGQAESLRLDLCCLSGTQEVLSQDSEGPTKSSKTEGAGTSISEPPSPVSPYASEGCGPLPLPLRPCGEGSEMVGKENSSPENKNWLLAIAAKRKAENSSPRSPSSQTPSSRRQSGKTSPGPVTITPSSMRKICTYFRRKTQDDFCSPEHSTEL

DTL

Denticleless protein homolog

720 amino acids

Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control, DNA damage response and translesion DNA synthesis. The DCX(DTL) complex, also named CRL4(CDT2) complex, mediates the polyubiquitination and subsequent degradation of CDT1, CDKN1A/p21(CIP1), KMT5A and SDE2. CDT1 degradation in response to DNA damage is necessary to ensure proper cell cycle regulation of DNA replication. CDKN1A/p21(CIP1) degradation during S phase or following UV irradiation is essential to control replication licensing. KMT5A degradation is also important for a proper regulation of mechanisms such as TGF-beta signaling, cell cycle progression, DNA repair and cell migration. Most substrates require their interaction with PCNA for their polyubiquitination: substrates interact with PCNA via their PIP-box, and those containing the 'K+4' motif in the PIP box, recruit the DCX(DTL) complex, leading to their degradation. In undamaged proliferating cells, the DCX(DTL) complex also promotes the 'Lys-164' monoubiquitination of PCNA, thereby being involved in PCNA-dependent translesion DNA synthesis (By similarity). May play a role in the regulation of the circadian clock (By similarity).

Belongs to the WD repeat cdt2 family.

78.633 kDa

MLCRALLLRAAGHRQSSSLPLQHLLDGYRCSREDDHLSYGEIGMPVPPFGCSFSAAPNFEHVLAVANEEGFVRLYDTEAQNTTKLISKEWQAHSNAVFDLAWVPGEHRIVTASGDQTAKVWDVRAGELLGICKGHQCSLKSVAFSRFEKAVFCTGGRDGNIMVWDTRCNKKDGFYRQVNQISGAHNVVDRQTPSKLRKKRQNLRGLAPLVDFQQSVTVVLLQDEHTLISAGAVDGVIKVWDLRKNYAAYRQDPVPSKSFFYPGTSTRKLGYSSLVLDSTGANLFANCTDDSIYMFNMTSLKTFPVAVFSGHQNSTFYIKSSISPDDQFLVSGSSDCNAYIWKVSEPSLPPRILVGHSQEVTSIAWCPSDFTKIATCSDDNTVRIWRLQHYPEEEKSVSNKAKLVGWVTQKKPEEQRGAGRSASPQSTPAKAFSVGSPCASSPRPAACAPSYSGDLPLSTNTPTVSLKTQMATACTPAKLSGASPRTSPKLVPSSKMSIKHWIARTPCSSPEVGKKTPSPRKALAEVTQSLLETSSTPKAQHSQAEKRAKRRLDCSKEDEAGQKCLQDCSCVTELDHVAKKSKLNLCHLAAGQRACDEGSLSLADLDNEHEDSTHSPKELSFPGSLVNPSGTQTPPPVLQSPCERDSDVVDKENSSPERKNWLSALGEKLRTGKAGSPPSSYTSSAKRQEAAVVTTSPKTAVNTSVSMRKICTYFHRKPQN

dtl

Denticleless protein homolog

713 amino acids

Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control, DNA damage response and translesion DNA synthesis. The DCX(DTL) complex, also named CRL4(CDT2) complex, mediates the polyubiquitination and subsequent degradation of CDT1, CDKN1A/p21(CIP1), KMT5A and SDE2. CDT1 degradation in response to DNA damage is necessary to ensure proper cell cycle regulation of DNA replication. CDKN1A/p21(CIP1) degradation during S phase or following UV irradiation is essential to control replication licensing. KMT5A degradation is also important for a proper regulation of mechanisms such as TGF-beta signaling, cell cycle progression, DNA repair and cell migration. Most substrates require their interaction with PCNA for their polyubiquitination: substrates interact with PCNA via their PIP-box, and those containing the 'K+4' motif in the PIP box, recruit the DCX(DTL) complex, leading to their degradation. In undamaged proliferating cells, the DCX(DTL) complex also promotes the 'Lys-164' monoubiquitination of PCNA, thereby being involved in PCNA-dependent translesion DNA synthesis (PubMed:16949367). May play a role in the regulation of the circadian clock (By similarity).

Belongs to the WD repeat cdt2 family.

78.193 kDa

MLFRSVVNKPRLGCRQRGVPFTHPLQSLLQCYQCAKHDEHTSYGELGAAVPPFGCAFSTVPDMSHVLAVANEEGIVRLYDTECRDVQRLVVKEFMAHTNAVFDIAWVPGEHKLVTASGDQTAKLWDVKAGDLIGECKGHQCSLKSVAFSKFEKAVFSTGGRDGNIMVWDTRCNKKDGFYRQVNQITGAHNALDKQTPSKVKKRKPYVRGLAPSVDSQQSVTVVIFQDEHTIISAGAVDGIVKVWDLRKNYSAYRQDPVPAKLFPYPGNSTRKLGYSNLVLDPTGTNLFASCTDDNVYMFNATGLKTEPVSVFGGHQNSTFYIKTSVSPDGQFLLSGSSDHSAYIWQVSDPKVPPVTLTGHCQEVTSVAWCQSDFTKIATCSDDNTVRVWRLKRSSEDSAQSDKTETVGWACQKKCVPPSMAANLCTPGKPSMIPSSSLMSSPTPATCAPSYTGDLPMPSSTPVSALLPIPKLQTPQRLNGEGLGASPKQTSSSKISIKDWITRTPKSSTRADTKTPSPRKAFTPVEQYPSVSSTRVQMPYEKRAKRRLETSSEDVEHVCLDHCNCVMELEPGLKKAKLDLCSFSEKERDGSDDKCLRLSDLSRGFDQEFSPGPSTSFLINGTVNPPLSPLSELKSDLRDKENSSPEKNWLSALGHKFKSDKSSPQNKAASSPSSRNSTSKKHPTRNAPNSPVSVPTTPGSMRKICTYFFKKSE

dtl

Denticleless protein homolog

647 amino acids

Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control, DNA damage response and translesion DNA synthesis. The DCX(DTL) complex, also named CRL4(CDT2) complex, mediates the polyubiquitination and subsequent degradation of CDT1, CDKN1A/p21(CIP1), KMT5A and SDE2. CDT1 degradation in response to DNA damage is necessary to ensure proper cell cycle regulation of DNA replication. CDKN1A/p21(CIP1) degradation during S phase or following UV irradiation is essential to control replication licensing. KMT5A degradation is also important for a proper regulation of mechanisms such as TGF-beta signaling, cell cycle progression, DNA repair and cell migration. Most substrates require their interaction with PCNA for their polyubiquitination: substrates interact with PCNA via their PIP-box, and those containing the 'K+4' motif in the PIP box, recruit the DCX(DTL) complex, leading to their degradation. In undamaged proliferating cells, the DCX(DTL) complex also promotes the 'Lys-164' monoubiquitination of PCNA, thereby being involved in PCNA-dependent translesion DNA synthesis (By similarity). May play a role in the regulation of the circadian clock (By similarity).

Belongs to the WD repeat cdt2 family.

70.769 kDa

MTLFHHVVDRGAKKRGRNGEQRLFPLSSLLDGYECARRDEHISYGASAAAVPPFGCTFSSAHGQQNCLAVANEEGFVTIFNTGEKQSSVLKEWQAHDNAVFDIAWVPGTNCLVTASGDQTARLWDVITGDLLGTFKGHQCSLKSVAFYKQEKAVFSTGGRDGNIMIWDTRCSKKDGFYRQVKQISGAHMKPERFTPQTKKRRGMAPPVDSQQGVTVVLFCDETKLISSGAVDGIIKMWDLRRNYTAYHQNPLPLQAYPYPGSCTRKLGYSGLSLDYTGSRLFSNCTDDNIYMFNISGLKTTPVAVFSGHSNSSFYVKSTVSPDDQFLASGSSDHNVYIWKISDPKQAPMMLQGHSQEVTSVAWCPTDFTKIASCSDDNTVRIWRLNRKPEGENSTIQDGNLVGWTIRKVQSPNRTPGHHSPVELTPSKNPGSVRSVSLASPQPATCAPTGAALPLPSNTSSAPPAKLTSPKMPSSLQQWISRSSKSPVRKALTPVLQGLSFEHRVKRRLETGDSASSGLGEEIDGVSELYPNVKRSRSSVSTLKKEDSFGLESEKRLGSDGAEASGKENSSPRRTDWLSVISQKFKGSAQPKSPSSGSSQQDTRTLESPAAVSPRPMKVFSPPTNKKASPSKPMKKISSYFMKRTQD