DTD1

D-aminoacyl-tRNA deacylase 1

209 amino acids

ATPase involved in DNA replication, may facilitate loading of CDC45 onto pre-replication complexes.

Belongs to the DTD family.

23.232 kDa

MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEVLCVSQFTLQCVLKGNKPDFHLAMPAEQAESFYKGFLEQLRKAYRPELVKDGKFGAYMQVHIQNDGPVTIELESPAPGAAASDPKQLSKLEKQQQRKEKTRAKGPSESSKERSAPRKEDRSASSGAEGDVSSEREP

DTD1

D-aminoacyl-tRNA deacylase 1

209 amino acids

An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS. Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality.

Belongs to the DTD family.

23.424 kDa

MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFTLQCVLKGNKPDFHLAMPTEQAEGFYNSFLEQLRKTYRPELIKDGKFGAYMQVHIQNDGPVTIELESPAPGTATSDPKQLSKLEKQQQRKEKTRAKGPSESSKERNTPRKEDRSASSGAEGDVSSEREP

Dtd1

D-aminoacyl-tRNA deacylase 1

209 amino acids

ATPase involved in DNA replication, may facilitate loading of CDC45 onto pre-replication complexes.

Belongs to the DTD family.

23.384 kDa

MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISMEDSQKELEHMVRKILNLRVFEDESGKHWSKSVMDKEYEVLCVSQFTLQCVLKGNKPDFHLAMPTEQAESFYNSFLEQLRKSYRPELIRDGKFGAYMQVHIQNDGPVTIELESPAPGAASSDPKQLSKLEKQQQRKEKTRAKGPSESSKERNAPRKEDRSASSGAEGDVSSEREP

dtd1

D-aminoacyl-tRNA deacylase 1

207 amino acids

D-aminoacyl-tRNA deacylase, with no observable activity on tRNAs charged with their cognate L-amino acid (By similarity). Hydrolyzes correctly charged, achiral, glycyl-tRNA(Gly) (PubMed:27224426). Deacylates mischarged D.melanogaster and E.coli glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS (PubMed:28362257). Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site (By similarity). By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality (By similarity).

Belongs to the DTD family.

23.037 kDa

MKAIIQRVTRASVTVGEEQISSIGRGLCVLLGISVEDTQKDVDYMVRKILNLRVFEDENGRAWSRSVMDGELEVLCVSQFTLQCLLKGNKPDYHAAMPAELAQPFYNNMLEQLRETYKPELIKDGQFGAKMQVLIQNDGPVTIQLESPPAPTDPKLLSKQEKQQQRKEKTRSKGPSDSSREKAAQRSKVDPSASSGAEGDVSSEREP

DTD1

D-aminoacyl-tRNA deacylase

154 amino acids

An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS. Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality.

Belongs to the DTD family.

16.628 kDa

MRAVIQRAKSGSVTVDSKIVSQISHGLVVLIGVGHEDTAEDVEKVANKIIKTKLWPSVDGAQQWKQSVLDVGGEVLCVSQFTLFAKVKKGQKPDFHNAAKGPQAKELYDQVLAKIQAALPEGRTVKDGVFGAMMDVALVNDGPVTIQYDTKNDK

dtd1

D-aminoacyl-tRNA deacylase 1

152 amino acids

An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs (By similarity). Hydrolyzes correctly charged, achiral, glycyl-tRNA(Gly) (PubMed:27224426). Deacylates mischarged D.melanogaster and E.coli glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS (PubMed:28362257). Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality (By similarity).

Belongs to the DTD family.

16.994 kDa

MKAVIQRVLSGSVTSEGEVVGSIQKGLAVLVGIARDDTADDTEYILRKILGVRVWSNEDGSKMWCRNVKEIDGEVLLISQFTLMHVMKGNKPDFHNAMPPEDALKVFNALRDKLRCEYAPHKIATGNFQHYMNIHLSNDGPVTLILDSKKRS

DTD1

D-aminoacyl-tRNA deacylase

150 amino acids

An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS. Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality.

Belongs to the DTD family.

16.411 kDa

MRIVLQKVSEASVTVGSAVVSQIKHGYMLLVGIGTDDKLEDIDKLSKKILTFRGFDDDAGYGWKRNISEVDGEILCVSQFTLMARTSKGTKPDFHLAQRGELANELYGQFMDKLKAGLGDDKVQNGVFGAMMSCKLTNEGPVTIIFDSKA

DTD1

D-aminoacyl-tRNA deacylase

150 amino acids

An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS. Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality.

Belongs to the DTD family.

16.807 kDa

MRVVIQRVSQASVVVENKLISSIKTGYMLLVGISTEDTIADIEKSVRKVSGLRLFPDDSNAQWKRSIKDIGGEVLSISQFTLIARTKKGTRPDFHEAQKGHLALEMYDRFLDLLRQELGEKQVQDGEFGAMMSCSLTNEGPVTIIYDTKE

DTD1

D-aminoacyl-tRNA deacylase

150 amino acids

An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs (Probable). Hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and free tRNA(Tyr) (PubMed:10766779). May also deacylate mischarged D-leucyl-tRNA(Leu) (PubMed:10918062). Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS (By similarity). Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site (By similarity). By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality (By similarity).

Belongs to the DTD family.

16.746 kDa

MKIVLQKVSQASVVVDSKVISSIKHGYMLLVGISIDDSMAEIDKLSKKVLSLRIFEDESRNLWKKNIKEANGEILSVSQFTLMAKTKKGTKPDFHLAQKGHIAKELYEEFLKLLRSDLGEEKVKDGEFGAMMSCSLTNEGPVTIILDSDQ

DTD1

D-aminoacyl-tRNA deacylase

149 amino acids

An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS. Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality.

Belongs to the DTD family.

16.59 kDa

MRIVIQKVSQAMVKVDNEIVSQIAKGYMLLVGISTEDTIADAQKLSNKVLNLRLFETGDQFWKHSIQDVQGEILSVSQFTLMARTKKGNKPDFHKAQKGEHAQELYNQFLDLLKTTLGADKVKDGQFGAMMSCSLTNEGPVTIILDSTE

dtd1

D-aminoacyl-tRNA deacylase

149 amino acids

An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS. Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality.

Belongs to the DTD family.

16.334 kDa

MKAVIQRVLNASVSVDDKIVSAIQQGYCILLGVGSDDTPEDVTKLSNKILKLKLFDNAEQPWKSTIADIQGEILCVSQFTLHARVNKGAKPDFHRSMKGPEAIELYEQVVKTLGESLGSDKIKKGVFGAMMNVQLVNNGPVTILYDTKE