dph4

Diphthamide biosynthesis protein 4

199 amino acids

Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2 (By similarity).

Belongs to the DPH4 family.

22.152 kDa

MIKSQTPRHDYYHILNLPFTTPPAALSKQQLKIAYHKALLKHHPDKAISVAATPARTHTHDTKTAYRSSPDRNADTSPTFTIDEITAAYKTLSDPALRAEYDRVLRLERVTAGKGDKGAEAAFHTGLEVVDLEDLVCEEMGDGEGLLCWYRGCRCGDERGFMVTEKDLEKEAEHGEVVIGCRGCSLWMKILFAMEEGDG

dph4

Diphthamide biosynthesis protein 4

188 amino acids

Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2 (By similarity).

Belongs to the DPH4 family.

20.548 kDa

MTQTSAAPTTTPSFYEILNLPFPSTGLSKQQLKIAYHKALLKHHPDKAVAVAKENLPSSNHGPAQPPSNQKITIDAITTAYKTLSDPVQRAEYDRVLRLDRNRVNGAGDKNGNGTVFHTGLEVVDLEDLDCDEGGDEAMWYMACRCGDERGFSLSESDLEREADSGEIVVGCRGCSLYTKVLFAVQDD

DPH4

Diphthamide biosynthesis protein 4

188 amino acids

Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2 (By similarity).

Belongs to the DPH4 family.

20.774 kDa

MTSSQSISSSADTATHYQVLNITSALLDTQHDSTPLIKRAYHRALLRNHPDKVANSDPSSVFFTVDQITTALNVLSSPSARVAYDAALRVSRPTGAAGRDGSFQTGVENVDLDDLAFDEDQECWYRPCRCGNEHSYEFREADLEEVSEEGELVVGCLDCSLWLRVHFAVLDENEDDVQPSSTTSKDKI

DPH4

Diphthamide biosynthesis protein 4

175 amino acids

Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2 (By similarity).

Belongs to the DPH4 family.

19.869 kDa

MTVKSKSRISHYEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQEAYRVLSNDQLRAAYNRALNDSNKLAGFNNFGDGLDEFNLDEFEFNEEKLEYVMTCPRCQSGGGFVLSEDMLEECIEDGLTESEEQGYQVLTQCTACSLWLKVNFFINDEEE

dph4

DPH4 homolog

170 amino acids

Stimulates the ATPase activity of several Hsp70-type chaperones. Plays a role in the diphthamide biosynthesis, a post-translational modification of histidine which occurs in translation elongation factor 2 (By similarity).

Belongs to the DPH4 family.

19.882 kDa

MTNSSNNSNKCENKNYYEILKVSIDADIEEIKKSYRKLALLYHPDKLNKEENIEENINNFSNCLVNNNNNNNNSNTKDFNDIQIAWETLKDDLLRKQYDSLLLEQKRQKYSVSDEIDLDDMEFIEENSEYVYPCRCGDHYIITEDQLSEGSDVVCCSGCSLSIKVIYQME

DPH4

Diphthamide biosynthesis protein 4

168 amino acids

Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2 (By similarity).

Belongs to the DPH4 family.

19.593 kDa

MDPYIEDRDIQKRSHYKVLGVVPTCNDLDIKSAYKEMLLAHHPDKNGNASTTINSIQEAYKTLIDPELRDQYDDSLKRSIQRQGFNITGDGLDIYCLDDFEMEEEEECKWLKDCPRCQFPKSIKFKESDLIENGTEDGDNGFDIIVQCESCSLWIKVKYYEINEEDDE

DPH4

Diphthamide biosynthesis protein 4

163 amino acids

Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2 (By similarity).

Belongs to the DPH4 family.

18.232 kDa

MNHYTILGLSEPPHVPELTSADLKTAYKQALLKNHPDKLQEREAYTGSVQITAITTAYACLSNSKLKKEYDLSLKNGANGVKSGPGSDVFDLTELEEREDADGMFSWYKPCRCGEAGGYVLTEEHLENNEKYYEGVDVQFHEIVVQCGTCSLWITVQYGVEEE

DPH4

Diphthamide biosynthesis protein 4

162 amino acids

Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2 (By similarity).

Belongs to the DPH4 family.

18.411 kDa

MQRSFYEILGIESDASNIEIKRAYRAMLLETHPDKSGLNYNSNGNNTSSHSVTDIQEAYQTLIDQDLRKKYDEELAESFKKLGFHNAGDGLDLFSLDLFDYSGDEQSFSMNCPRCQITDGFQLTEDALEEHAIDYEGGGYFVLVQCSACSLWLKVLFDVMEE

DPH4

Diphthamide biosynthesis protein 4

156 amino acids

Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2 (By similarity).

Belongs to the DPH4 family.

17.062 kDa

MDGSHYDILGIAVDAEPLEVRQAYRQRLLEAHPDKQGGVDKGAVTRIQQAYRVLSDPTQRSAYDGELAVQIAATGVHGRADALDEHSLDDFEYNEQQGVFTMACPRCSSAEGFELPEQALEENATARPGGGMQVIVQCAACSLWLKVDFDIVYTSE

dph4

Diphthamide biosynthesis protein 4

139 amino acids

Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2 (By similarity).

Belongs to the DPH4 family.

16.097 kDa

MNHYSVLNLKDGKTYTDDEIKEAYRKALLLFHPDKCKEKPSVVYTIDQVKEAYQVLSSEKDRQQYQIKQEEESSHYYSIVDLSEFEELDNGSYYYPCRCGDLGGYVVTEDDLENNRSVVPCMGCSLTIQVDYEIAESDS