Function
Transcriptional activator that binds specifically to the DNA consensus core sequence 5'-AAAG-3' also known as prolamin box (PubMed:16798940). Can activate the expression of genes encoding for the seed storage proteins glutelin, prolamin and globulin. Functions synergistically with RISBZ/BZIP58 to positively regulate quantitatively many seed storage proteins (PubMed:16798940, PubMed:19473328). Functions synergistically with RISBZ1/BZIP58 to positively regulate some metabolic enzymes, such as alanine aminotransferase and pyruvate phosphate dikinase, that are expressed in developing seeds (PubMed:16798940). Functions synergistically with RISBZ1/BZIP58 to positively regulate genes that are key players in the development of aleurone layers (PubMed:19473328). Functions synergistically with RISBZ1/BZIP58 to positively regulate the glutelin GLUD-1 gene in endosperm of developing seeds (PubMed:18980953). Can activate the expression of the bifunctional lysine-degrading enzyme, lysine ketoglutarate reductase/saccharopine dehydrogenase (LKR/SDH), one of the key regulators determining free lysine content in plants (PubMed:21037241). In germinating seeds, involved in the gibberellin-mediated activation of the alpha-amylase AMY1.1/AMY1A gene (PubMed:14500792).
Sequence
MASGGALSPVEEKPTVVKTTKAEQHEEEAAVAVKSAAEMMKKSSPCCPRCNSIKTKFCYYNNYSMAQPRYFCRECRRYWTQGGSLRNVPVGGGCRKSKRSSASSASASAASPPAPAVGAAPPVVPALSSAISKLLQSEPMAAPCADFPNVLPTFVSTGFELPAAAGDRLSLGSFGAFGNLSAAVAAPGGGGGSSTTTSFMDMLRGVGGLFDGVGNSHQMGGNGGGGGSYYAPLITGAGNGMLMPPPPLPPFSGSLMQHGMQGLFANHAMGGGGGGVMNAGEDGSVMAGLGGGQWPPALGGADEQQGGGDGGEAVMTKDTGGGASSSASRPDYFYGWNSAAGGVVAGGGIGGNAAAATGATPWQGLIDSSSAMM