DNA-C

Cell cycle link protein

169 amino acids

Interacts with and disrupts the function of host retinoblastoma-related proteins RBR, which are key regulators of the cell cycle. Induces transcriptional activation of E2F-regulated S-phase and G2/M-phase-specific genes. Inactivation of the ability of RBR to arrest the cell cycle leads to the stimulation of viral DNA replication.

Belongs to the nanovirus Clink protein family.

19.732 kDa

MGLKYFSHLPEELREKIVHDHLQQERKKEFLEKAIEDSCRRHVSLLKSDPSPSEMYSLSKFLDSLADYVGRQFNTRCLIKWRKDVPANIKFQVMEEQHLRLYGFLDMDDLSCRELLPPEEDDDITYEDGMIVNCSELDKLFAALGIRVVYITVSNNCICTPLNKDIVIS

DNA-C

Cell cycle link protein

169 amino acids

Interacts with and disrupts the function of host retinoblastoma-related proteins RBR, which are key regulators of the cell cycle. Induces transcriptional activation of E2F-regulated S-phase and G2/M-phase-specific genes. Inactivation of the ability of RBR to arrest the cell cycle leads to the stimulation of viral DNA replication (By similarity).

Belongs to the nanovirus Clink protein family.

19.684 kDa

MGLKYFSHLPEELRQKIVHDHLQQERKKEFLEKAIEDSCRRHVSLLKSDPSPSELYALSKFLDSLADYVGKQFNTRCLIKWKKDVPANIKFEVMEEQHLRLYGFVDMDDLLCREVLPPEEDDDITYEDGMIVNCSELDKLFEALGIKVVYITVSKNCICTPLNKDIVIS

DNA-C

Cell cycle link protein

169 amino acids

Interacts with and disrupts the function of host retinoblastoma-related proteins RBR, which are key regulators of the cell cycle. Induces transcriptional activation of E2F-regulated S-phase and G2/M-phase-specific genes. Inactivation of the ability of RBR to arrest the cell cycle leads to the stimulation of viral DNA replication (By similarity).

Belongs to the nanovirus Clink protein family.

19.691 kDa

MGLKYFAHLPLELREKIVRDHLQEERKKEFLEKAIEDSCRRHEALLIEDPSPAELNSLSKFLTALSDYVGNQFNTRCLIRWKKDVPSKVKFGFMDEQHHKLYGSMDMDDLSCGELFIPDEEDDLTYEDGVIVRCSQLDQLFKSLGIEIVYIVVSKHCIWAPLSKEIVIK

DNA-C

Cell cycle link protein

164 amino acids

Interacts with and disrupts the function of host retinoblastoma-related proteins RBR, which are key regulators of the cell cycle. Induces transcriptional activation of E2F-regulated S-phase and G2/M-phase-specific genes. Inactivation of the ability of RBR to arrest the cell cycle leads to the stimulation of viral DNA replication (By similarity).

Belongs to the nanovirus Clink protein family.

19.065 kDa

MALRYFSHLPEELKEKIMNEHLKEIKKKEFLENVIKAACAVFEGLTKKESVEEDDILRFSGFLEGLSAYYAEATKKKCLVRWKKSVAINLKWRVMEEMHYKLYGFADMEDLYCSELGFPNYGEDDVAYHDGAIVNCKQLEVVFDDLGIEFMSIVIDRGSIKIEL

DNA-C

Cell cycle link protein

161 amino acids

Interacts with and disrupts the function of host retinoblastoma-related proteins RBR, which are key regulators of the cell cycle. Induces transcriptional activation of E2F-regulated S-phase and G2/M-phase-specific genes. Inactivation of the ability of RBR to arrest the cell cycle leads to the stimulation of viral DNA replication (By similarity). Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

18.972 kDa

MEFWESSAMPDDVKREIKEIYWEDRKKLLFCQKLKSYVRRILVYGDQEDALAGVKDMKTSIIRYSEYLKKPCVVICCVSNKSIVYRLNSMVFFYHEYLEELGGDYSVYQDLYCDEVLSSSSTEEEDVGVIYRNVIMASTQEKFSWSDCQQIVISDYDVTLL