DMAC2L

ATP synthase subunit s, mitochondrial

215 amino acids

Involved in regulation of mitochondrial membrane ATP synthase. Necessary for H(+) conduction of ATP synthase. Facilitates energy-driven catalysis of ATP synthesis by blocking a proton leak through an alternative proton exit pathway.

Belongs to the ATP synthase subunit s family.

24.866 kDa

MCCAVSEQRLTCADQMMPFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDCLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGVREKENLVQAFKTALPSLELKLQLK

DMAC2L

ATP synthase subunit s, mitochondrial

200 amino acids

Involved in regulation of mitochondrial membrane ATP synthase. Necessary for H(+) conduction of ATP synthase. Facilitates energy-driven catalysis of ATP synthesis by blocking a proton leak through an alternative proton exit pathway.

Belongs to the ATP synthase subunit s family.

23.293 kDa

MMLFGKISQQLCGLKKLPWSRDSRYFWGWLNAVFNKVDHDRIRDVGPDRAASEWLLRCGAMVRYHGQQRWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALHHFRNLKYLFLSDLPGVKEKEKIVQAFKTSLPSLELKLDLK

DMAC2L

ATP synthase subunit s, mitochondrial

200 amino acids

Involved in regulation of mitochondrial membrane ATP synthase. Necessary for H(+) conduction of ATP synthase. Facilitates energy-driven catalysis of ATP synthesis by blocking a proton leak through an alternative proton exit pathway.

Belongs to the ATP synthase subunit s family.

23.14 kDa

MMLFGKVSQQLCGIKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRCGAMVRYHGQERWQTDYNHLPTGPLDKYKIQAIDATNSCIMSIGFDHMVGLQHVEKIRLCKCHFIEDDCLLRLGQLENLQKSILEMEIISCGNITDKGIIASRHLRNLKYLLLSDLPGVREKENLIQVFETALPSLELKLQLK

Dmac2l

ATP synthase subunit s, mitochondrial

200 amino acids

Involved in regulation of mitochondrial membrane ATP synthase. Necessary for H(+) conduction of ATP synthase. Facilitates energy-driven catalysis of ATP synthesis by blocking a proton leak through an alternative proton exit pathway.

Belongs to the ATP synthase subunit s family.

23.275 kDa

MMMFGKISRQLCSLKKIPWSCDSRYFWEWLNTVFNKVDYERLRDVGPDRAASEWLLRCGAKVRYCGHQKWLHDYNTLPGSSIDRYKIQAIDATDSCIMDIGLDHMVGLEHVEKITLCKCHYIEDNCLQRLSQLENLRKSLLELEIIACGNVTDNGVIALRHFRNLKYLFLSDLPGVKDKEYLAQVFKTALPSLELKLNLK

DMAC2L

ATP synthase subunit s, mitochondrial

200 amino acids

Involved in regulation of mitochondrial membrane ATP synthase. Necessary for H(+) conduction of ATP synthase. Facilitates energy-driven catalysis of ATP synthesis by blocking a proton leak through an alternative proton exit pathway.

Belongs to the ATP synthase subunit s family.

23.199 kDa

MMLFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDCLLRLSQLENLQKTILEMEIISCGNITDKGIIALLHLRNLKYLLLSDLPGVREKENLVQAFKTALPSLELKLQLK

Dmac2l

ATP synthase subunit s, mitochondrial

200 amino acids

Involved in regulation of mitochondrial membrane ATP synthase. Necessary for H(+) conduction of ATP synthase. Facilitates energy-driven catalysis of ATP synthesis by blocking a proton leak through an alternative proton exit pathway.

Belongs to the ATP synthase subunit s family.

23.324 kDa

MMMFGKISRQLFSLKKIPWSCDSRYFWEWLNTVFNKVDYERIKDVGPDRAASEWLLRCGAKVRYCGHQKWLQDYNKLPGGSVDRYKIQAIDATDSCIMDIGFDHLVGLEHVERITLCRCHYIEDNCLQRLSQLENLRKSLLELEIIACGNVTDNGVIALRHFKNLKYLFLSDLPGIKDKEYLAEVFTKALPSLELKLNLK