About Products Protein Database Contact

DHRS7C

Gene
DHRS7C
Protein
Dehydrogenase/reductase SDR family member 7C
Organism
Homo sapiens
Length
312 amino acids
Function
Putative oxidoreductase.
Similarity
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Mass
34.878 kDa
Sequence
MGVMAMLMLPLLLLGISGLLFIYQEVSRLWSKSAVQNKVVVITDAISGLGKECARVFHTGGARLVLCGKNWERLENLYDALISVADPSKQTFTPKLVLLDLSDISCVPDVAKEVLDCYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKALLPNMISRRTGQIVLVNNIQGKFGIPFRTTYAASKHAALGFFDCLRAEVEEYDVVISTVSPTFIRSYHVYPEQGNWEASIWKFFFRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANPIPKAAVYVRTFFPEFFFAVVACGVKEKLNVPEEG

Gene
DHRS7C
Protein
Dehydrogenase/reductase SDR family member 7C
Organism
Bos taurus
Length
311 amino acids
Function
Putative oxidoreductase.
Similarity
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Mass
34.422 kDa
Sequence
MGVTAVLMLPLLLLGISGLLFIYQEVSRLWSKSVVQNKVVVITDAISGLGKECARVFHTGGARLVLCGKNWERLQSLYDALISVADPSKTFTPKLVLLDLSDISCVQDVAKEVLDCYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPIILTKALLPDMISRRTGQIVLVNNIQGKLGIPFRTAYAASKHAALGFFDCLRAEVEEYDVVVSTVSPTFIRSYHVDPGQGNWEASIWKFFFRKLTYGTHPVDVAEEVMRTVRRKKQEVFLANPIPKAAVYIRTLFPELFFAVVACGVKEKLSVPEEG

Gene
Dhrs7c
Protein
Dehydrogenase/reductase SDR family member 7C
Organism
Mus musculus
Length
311 amino acids
Function
Putative oxidoreductase.
Similarity
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Mass
34.468 kDa
Sequence
MGLMAVLMLPLLLLGISGLLFIYQEASRLWSKSAVQNKVVVITDAISGLGKECARVFHAGGARLVLCGKNWEGLESLYATLTSVADPSKTFTPKLVLLDLSDISCVQDVAKEVLDCYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKVLLPNMISRRTGQIVLVNNIQAKFGIPFRTAYAASKHAVMGFFDCLRAEVEEYDVVVSTVSPTFIRSYRASPEQRNWETSICKFFCRKLAYGVHPVEVAEEVMRTVRRKKQEVFMANPVPKAAVFIRTFFPEFFFAVVACGVKEKLNVPEEG

Gene
dhrs7c
Protein
Dehydrogenase/reductase SDR family member 7C
Organism
Xenopus tropicalis
Length
311 amino acids
Function
Putative oxidoreductase.
Similarity
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Mass
34.615 kDa
Sequence
MGFLTFLIVPLLILGISGIVYIYREVVRLMSRSALKNKVVVITDAISGLGKECSRVFHSAGARLVLCGKTWEKLEALHDALISVADPSVTFTPKLVLLDISDINNMEAMGKEIQDCYGCVDVLINNASMKMKGPLQSVSLELDKKIMDANYFGPITLVKAILPHMISRRTGQIVLVNTIQGKIGVPFRAAYAASKHAIQGFFDCLRAEVEEFDVSVSTVSPTFIRSYHVQPQPGNWEASIWKFFFRKLSYGAHPVEVAEEVLSTVSRKKQEVFMANPIPRAAVYIRTFLPELFFAVVATGVKEKHFVEEEK