denr

Density-regulated protein homolog

224 amino acids

Belongs to the DENR family.

24.747 kDa

MSDTESSTPSQPIVVVEYCKICSLPTEYCEYGPSAKQCLKENGPHPNNNKNTASGKDSSNTTATTTTTDTTTTTTTSTENTEEKLKDLKIVDDSKEVSHVDAGKSESKEATGEEKEKEKVSKKKKEVKPQIIIEVNQRNKRKHVTKITGLELYGIKLSDAAKVMAKKFSCGCSVVKSISNPNSEDIDIQGDFGEELVDLIEEKYPTVPLSEIYFLEDKKKVKAR

denr

Density-regulated protein

208 amino acids

May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Involved in translation initiation; promotes recruitment of aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (By similarity).

Belongs to the DENR family.

22.804 kDa

MATTENAESGSPENKVDRADPDAKYPLKVLYCGVCSLPAEYCEYMPEPAKCKQWLEKNFPDVFAKLTLGTAPKQESKGGGGGEDGGGGRGRGEAPPAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFDIELKEAQRFFAQKFSCGASVTAEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIDDLGEVKK

DENR

Density-regulated protein

198 amino acids

May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Involved in translation initiation; promotes recruitment of aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (By similarity).

Belongs to the DENR family.

22.217 kDa

MAADISESGGHDCRGDQRSNTKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK

DENR

Density-regulated protein

198 amino acids

May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Involved in translation initiation; promotes recruitment of aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (By similarity).

Belongs to the DENR family.

22.158 kDa

MATDVAEPVVPDCRGDIRSGARSDADYPLRVLYCGVCSLPTEYCEYMPDVTKCRQWLEKNFPDEFAKLTVENSPKQEAGVGEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK