DBP

Major DNA-binding protein

1235 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein (PubMed:8230421). May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

133.879 kDa

MSHEELTALAPVGPAAFLYFSRLNAETQEILATLSLCDRSSSVVIAPLLAGLTVEADFGVSVRTPVLCYDGGVLTKVTSFCPFALYFHHTQGIVAFTEDHGDVHRLCEDARQKYALEAYMPEADRVPTDLAALCAAVGCQASETTVHVVVGNGLKEFLFAGQLIPCVEEATTVRLHGGEAVRVPLYPPTLFNSLQLDAEADEVSLDARSAFVEARGLYVPAVSETLFYYVYTSWCQSLRFSEPRVLIEAALRQFVHDSQQSVKLAPHKRYLGYMSQRLSSLEKDHLMLSDAVVCELAFSFASVFFDSAYQPAESMLFSEWPLVTNATDHRDLIRALTELKLHLSTHVAALVFSANSVLYQHRLVYLQSSARHPSAGGTASQETLLKAIQFTNGLSAACEDVYNDARKVLKFQGAPLKDERYGPQHLALVCGTCPQLVSGFVWYLNRVSVYNTGLSGSSTLTNHLVGCAAGLCEACGGTCCHTCYQTAFVRVRTRLPVVPKQPKKEPCVITVQSRFLNDVDILGSFGRRYNVDAKDGGLDGKGDDGVPGGGAGGGGGRDVSGGPSDGLGGGRGGGGGGDSGGMMGRGGRMLGASVDRTYRLNRILDYCRKMRLIDPVTGEDTFSAHGKSDFVAVFSALNKFVDDEALGFVSEVRLKSSRDEVAGATQAFNLDLNPYAVAFQPLLAYAYFRSVFYVIQNVALITATSYIVDNPLTTNLVSKWMTQHFQSIHGAFSTTSSRKGFLFTKQIKSSKNSDHDRLLDFRLYAQGTYAVVPMEIKLSRLSVPTLIMVRVKNRPIYRAGKGNAGSVFFRRDHVPRRNPAKGCLGFLLYRHHERLFPECGLPCLQFWQKVCSNALPKNVPIGDMGEFNAFVKFLVAVTADYQEHDLLDVAPDCVLSYVESRFHNKFLCYYGFKDYIGSLHGLTTRLTTQNHAQFPHVLGASPRFSSPAEFALHVKGLKTAGVPAPMAATVARESLVRSVFEHRSLVTVPVSVEKYAGINNSKEIYQFGQIGYFSGNGVERSLNVSSMSGQDYRFMRQRYLLATRLADVLIKRSRRENVLFDADLIKNRVMLALDAENLDCDPEVMAVYEILSVREEIPASDDVLFFVDGCEALAASLMDKFAALQEQGVEDFSLENLRRVLDADAQRLTDAAGGEVHDLSALFAPSGVGAASGVGGGGLLLGESVAGNSICFGVPGETGGGCFLVNAGEDEAGGVGGSSGGGGGSGLLPAKRSRL

DBP

Major DNA-binding protein

1235 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

133.849 kDa

MSHEELTALAPVGPAAFLYFSRLNAETQEILATLSLCDRSSSVVIAPLLAGLTVEADFGVSVRTPVLCYDGGVLTKVTSFCPFALYFHHTQGIVAFTEDHGDVHRLCEDARQKYALEAYTPEADRVPTDLAALCAAVGCQASETTVHVVVGNGLKEFLFAGQLIPCVEEATTVRLHGGEAVRVPLYPPTLFNSLQLDAEADEVSLDARSAFVEARGLYVPAVSETLFYYVYTSWCQSLRFSEPRVLIEAALRQFVHDSQQSVKLAPHKRYLGYMSQRLSSLEKDHLMLSDAVVCELAFSFASVFFDSAYQPAESMLFSEWPLVTNATDHRDLIRALTELKLHLSTHVAALVFSANSVLYQHRLVYLQSSARHPSAGGTASQETLLKAIQFTNGLSAACEDVYNDARKVLKFQGAPLKDERYGPQHLALVCGTCPQLVSGFVWYLNRVSVYNTGLSGSSTLTNHLVGCAAGLCEACGGTCCHTCYQTAFVRVRTRLPVVPKQPKKEPCVITVQSRFLNDVDILGSFGRRYNVDAKDGGLDGKGDDGVPGGGAGGGGGRDVSGGPSDGLGGGRGGGGGGDSGGMMGRGGRMLGASVDRTYRLNRILDYCRKMRLIDPVTGEDTFSAHGKSDFVAVFSALNKFVDDEALGFVSEVRLKSSRDEVAGATQAFNLDLNPYAVAFQPLLAYAYFRSVFYVIQNVALITATSYIVDNPLTTNLVSKWMTQHFQSIHGAFSTTSSRKGFLFTKQIKSSKNSDHDRLLDFRLYAQGTYAVVPMEIKLSRLSVPTLIMVRVKNRPIYRAGKGNAGSVFFRRDHVPRRNPAKGCLGFLLYRHHERLFPECGLPCLQFWQKVCSNALPKNVPIGDMGEFNAFVKFLVAVTADYQEHDLLDVAPDCVLSYVESRFHNKFLCYYGFKDYIGSLHGLTTRLTTQNHAQFPHVLGASPRFSSPAEFALHVKGLKTAGVPAPMAATVARESLVRSVFEHRSLVTVPVSVEKYAGINNSKEIYQFGQIGYFSGNGVERSLNVSSMSGQDYRFMRQRYLLATRLADVLIKRSRRENVLFDADLIKNRVMLALDAENLDCDPEVMAVYEILSVREEIPASDDVLFFVDGCEALAASLMDKFAALQEQGVEDFSLENLRRVLDADAQRLTDAAGGEVHDLSALFAPSGVGAASGVGGGGLLLGESVAGNSICFGVPGETGGGCFLVNAGEDEAGGVGGSSGGGGGSGLLPAKRSRL

DBP

Major DNA-binding protein

1209 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

129.983 kDa

MESAPKTVSLPVSPLGYVYARQKASLQTGTVSLTAARSVDSDLAVLPVIRGLTVEQTFTTNVAVVAGSKTTGLGGTGITLKLTPSHFNPNAFVFYGGSVIGASSNAPNLTRACEAARRRFGFSAFSSPPVENAVETSGEEICASLNLSPETTALYLVVTESFKEMVYVCNTFLHYGGTSTVTIDGQDAMKIPIYPVQLYMPDVNRLASEPFNAKHRSIGDEFVYSRPFFNSDLCRLLHGYVLGPAAVALRVRNLDGVARGAAHLALDENHEGSVLPQDVTFTLFDSTQGNAGKGSGRAQRQGDGSGSKNSASSGIERRLASVMAADTALSVDSIMGAGIYDTELPSVEDWPVLSSGDDTESLEALGAYAARLSGLVGAMVFSANSVLYMTEVDDGGPADGKDGSNPSYHRFYLIAAPYVAGNPQTDKDGRVLPHTADQQAAPINGSNQEFSLDYLALACGFCPQILARLLFYLERCDAGTFGGRNETDALRYLANTLESDVPCGLCNQATRPACAHTTLHRLRQRLPRFGAPVRAPIGIFGTMNSAYSDCDVLGNYASYGALKRPNDNEAPKSIMQDTYRATMERLVNELEQAKLIDKETLAQASPCSAPTSVVHDQASFIGLLSNIKDTIEGAAEQFMRTLVEARDFKIREGLADANHTMSISLDPYSSSFCPVTSFLARRTVFAVLQDLVLSQCHCLFYGQSVEGRNFRNQFQPVLRRRFLDMLNGGFITAKTVTVTVSDSGVLAPDLTRPASEPPTKDYDGDMARVSMEVLRDLRVKNRVLFSNGGANMSEAARARVAGMASAYRRPDKGSNILNGAVGFLVKQYHGVLFPRGHPPGIDTPNPQWFWTLLQRNQMPARLLSKEDIETITAIKRFSDEYSAINFINLTPNNIGELAQFYFANLVLKYCDHSQYFINGLTAIVVGSRRPRDPAAVLAWIDRTINGAADVEPAAQEVLQRLGSNPAAWTGTFTSTNMVRYVMDQRPMVVIGLSISKYNGSAGNNRVFQAGNWNGLNGGKNVCPLMAFDRTRRFVLACPRVGFTCEAGGFGTGVRENTLSEQVRGIVSEGGPMVQTAVFAAVLHALGARTQHLAVDDWIGLVDDEFLAASLDALNATVVDQFGEWSVEAAQELVKNMEAQTTAGAVAAGEGAFDFGACVGDTPQQSTSAFNGGLAMAAAPAGQKRSLPDDILFDMGAPPEKKSGLTFDML

DBP

Major DNA-binding protein

1209 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

129.956 kDa

MESAPKTVSLPVSPLGYVYARQKASLQTGTVSLTAARSVDSDLAVLPVIRGLTVEQTFTTNVAVVAGSKTTGLGGTGITLKLTPSHFNPSAFVFYGGSVIGASSNAPNLTRACEAARRRFGFSAFSSPPVENAVETSGEEICASLNLSPETTALYLVVTESFKEMVYVCNTFLHYGGTSTVTIDGQDAMKIPIYPVQLYMPDVNRLASEPFNAKHRSIGDEFVYSRPFFNSDLCRLLHGYVLGPAAVALRVRNLDGVARGAAHLALDENHEGSVLPQDVTFTLFDSTQGNAGKGSGRAQRQGDGSGSKNSASSGIERRLASVMAADTALSVDSIMGAGIYDTELPSVEDWPVLSSGDDTESLEALGAYAARLSGLVGAMVFSANSVLYMTEVDDGGPADGKDGSNPSYHRFYLIAAPYVAGNPQTDKDGRVLPHTADQQAAPINGSNQEFSLDYLALACGFCPQILARLLFYLERCDAGTFGGRNETDALRYLANTLESDVPCGLCNQATRPACAHTTLHRLRQRLPRFGAPVRAPIGIFGTMNSAYSDCDVLGNYASYGALKRPNDNEAPKSIMQDTYRATMERLVNELEQAKLIDKETLAQASPCSAPTSVVHDQASFIGLLSNIKDTIEGAAEQFMRTLVEARDFKIREGLADANHTMSISLDPYSSSFCPVTSFLARRTVFAVLQDLVLSQCHCLFYGQSVEGRNFRNQFQPVLRRRFLDMLNGGFITAKTVTVTVSDSGVLAPDLTRPASEPPTKDYDGDMARVSMEVLRDLRVKNRVLFSNGGANMSEAARARVAGMASAYRRPDKGSNILNGAVGFLVKQYHGVLFPRGHPPGIDTPNPQWFWTLLQRNQMPARLLSKEDIETITAIKRFSDEYSAINFINLTPNNIGELAQFYFANLVLKYCDHSQYFINGLTAIVVGSRRPRDPAAVLAWIDRTINGAADVEPAAQEVLQRLGSNPAAWTGTFTSTNMVRYVMDQRPMVVIGLSISKYNGSAGNNRVFQAGNWNGLNGGKNVCPLMAFDRTRRFVLACPRVGFTCEAGGFGTGVRENTLSEQVRGIVSEGGPMVQTAVFAAVLHALGARTQHLAVDDWIGLVDDEFLAASLDALNATVVDQFGEWSVEAAQELVKNMEAQTTAGAVAAGEGAFDFGACVGDTPQQSTSAFNGGLAMAAAPAGQKRSLPDDILFDMGAPPEKKSGLTFDML

DBP

Major DNA-binding protein

1204 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

132.14 kDa

MENTQKTVTVPTGPLGYVYACRVEDLDLEEISFLAARSTDSDLALLPLMRNLTVEKTFTSSLAVVSGARTTGLAGAGITLKLTTSHFYPSVFVFHGGKHVLPSSAAPNLTRACNAARERFGFSRCQGPPVDGAVETTGAEICTRLGLEPENTILYLVVTALFKEAVFMCNVFLHYGGLDIVHINHGDVIRIPLFPVQLFMPDVNRLVPDPFNTHHRSIGEGFVYPTPFYNTGLCHLIHDCVIAPMAVALRVRNVTAVARGAAHLAFDENHEGAVLPPDITYTYFQSSSSGTTTARGARRNDVNSTSKPSPSGGFERRLASIMAADTALHAEVIFNTGIYEETPTDIKEWPMFIGMEGTLPRLNALGSYTARVAGVIGAMVFSPNSALYLTEVEDSGMTEAKDGGPGPSFNRFYQFAGPHLAANPQTDRDGHVLSSQSTGSSNTEFSVDYLALICGFGAPLLARLLFYLERCDAGAFTGGHGDALKYVTGTFDSEIPCSLCEKHTRPVCAHTTVHRLRQRMPRFGQATRQPIGVFGTMNSQYSDCDPLGNYAPYLILRKPGDQTEAAKATMQDTYRATLERLFIDLEQERLLDRGAPCSSEGLSSVIVDHPTFRRILDTLRARIEQTTTQFMKVLVETRDYKIREGLSEATHSMALTFDPYSGAFCPITNFLVKRTHLAVVQDLALSQCHCVFYGQQVEGRNFRNQFQPVLRRRFVDLFNGGFISTRSITVTLSEGPVSAPNPTLGQDAPAGRTFDGDLARVSVEVIRDIRVKNRVVFSGNCTNLSEAARARLVGLASAYQRQEKRVDMLHGALGFLLKQFHGLLFPRGMPPNSKSPNPQWFWTLLQRNQMPADKLTHEEITTIAAVKRFTEEYAAINFINLPPTCIGELAQFYMANLILKYCDHSQYLINTLTSIITGARRPRDPSSVLHWIRKDVTSAADIETQAKALLEKTENLPELWTTAFTSTHLVRAAMNQRPMVVLGISISKYHGAAGNNRVFQAGNWSGLNGGKNVCPLFTFDRTRRFIIACPRGGFICPVTGPSSGNRETTLSDQVRGIIVSGGAMVQLAIYATVVRAVGARAQHMAFDDWLSLTDDEFLARDLEELHDQIIQTLETPWTVEGALEAVKILDEKTTAGDGETPTNLAFNFDSCEPSHDTTSNVLNISGSNISGSTVPGLKRPPEDDELFDLSGIPIKHGNITMEMI

DBP

Major DNA-binding protein

1199 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

131.712 kDa

MENTQKTVTVPTGPLGYVYACRVEDLDLEEISFLAARSTDSDLALLPLMRNLTVEKTFTSSLAVVSGARTTGLAGAGITLKLTTSHFYPSVFVFHGGKHVLPSSAAPNLTRACNAARERFGFSRCQGPPVDGAVETTGAEICTRLGLEPENTILYLVVTALFKEAVFMCNVFLHYGGLDIVHINHGDVIRIPLFPVQLFMPDVNRLVPDPFNTHHRSIGEGFVYPTPFYNTGLCHLIHDCVIAPMAVALRVRNVTAVARGAAHLAFDENHEGAVLPPDITYTYFQSSSSGTTTARGARRNDVNSTSKPSPSGGFERRLASIMAADTALHAEVIFNTGIYEETPTDIKEWPMFIGMEGTLPRLNALGSYTARVAGVIGAMVFSPNSALYLTEVEDSGMTEAKDGGPGPSFNRFYQFAGPHLAANPQTDRDGHVLSSQSTGSSNTEFSVDYLALICGFGAPLLARLLFYLERCDAGAFTGGHGDALKYVTGTFDSEIPCSLCEKHTRPVCAHTTVHRLRQRMPRFGQATRQPIGVFGTMNSQYSDCDPLGNYAPYLILRKPGDQTEAAKATMQDTYRATLERLFIDLEQERLLDRGAPCSSEGLSSVIVDHPTFRRILDTLRARIEQTTTQFMKVLVETRDYKIREGLSEATHSMALTFDPYSGAFCPITNFLVKRTHLAVVQDLALSQCHCVFYGQQVEGRNFRNQFQPVLRRRFVDLFNGGFISTRSITVTLSEGPVSAPNPTLGQDAPAGRTFDGDLARVSVEVIRDIRVKNRVVFSGNCTNLSEAARARLVGLASAYQRQEKRVDMLHGALGFLLKQFHGLLFPRGMPPNSKSPNPQWFWTLLQRNQMPADKLTHEEITTIAAVKRFTEEYAALNFINLPPTCIGELAQFYMANLILKYCDHSQYLINTLTSIITGARRPRDPSSVLHWIRKDVTSAADIETQAKALLEKTENLPELWTTAFTSTHLVRAAMNQRPMVVLGISISKYHGAAGNNRVFQAGNWSGLNGGKNVCPLFTFDRTRRFIITCPRGGFICPVTGPSSGNRETTLSDQVRGIIVSGGAMVQLAIYATVVRAVGARAQHMAFDDWLSLTDDEFLARDLEELHDQIIQTLETPWTVEGALEAVKILDEKTTAGDGETPTNLAFNFDSCEPSHDTTSNVLNISGSTVPGLKRPPEDDELFDLSGIPIKHGNITMEMI

DBP

Major DNA-binding protein

1197 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

128.413 kDa

MDTKPKTTTTVKVPPGPMGYVYGRACPAEGLELLSLLSARSGDADVAVAPLIVGLTVESGFEANVAAVVGSGTTGLGGTAVSLKLMPSHYSPSVYVFHGGRHLAPSTQAPNLTRLCERARRHFGFSDYAPRPCDLKHETTGDALCERLGLDPDRALLYLVITEGFREAVCISNTFLHLGGMDKVTIGDAEVHRIPVYPLQMFMPDFSRVIADPFNCNHRSIGENFNYPLPFFNRPLARLLFEAVVGPAAVALRARNVDAVARAAAHLAFDENHEGAALPADITFTAFEASQGKPQRGARDAGNKGPAGGFEQRLASVMAGDAALALESIVSMAVFDEPPPDITTWPLLEGQETPAARAGAVGAYLARAAGLVGAMVFSTNSALHLTEVDDAGPADPKDHSKPSFYRFFLVPGTHVAANPQLDREGHVVPGYEGRPTAPLVGGTQEFAGEHLAMLCGFSPALLAKMLFYLERCDGGVIVGRQEMDVFRYVADSGQTDVPCNLCTFETRHACAHTTLMRLRARHPKFASAARGAIGVFGTMNSAYSDCDVLGNYAAFSALKRADGSENTRTIMQETYRAATERVMAELEALQYVDQAVPTALGRLETIIGNREALHTVVNNIKQLVDREVEQLMRNLIEGRNFKFRDGLAEANHAMSLSLDPYTCGPCPLLQLLARRSNLAVYQDLALSQCHGVFAGQSVEGRNFRNQFQPVLRRRVMDLFNNGFLSAKTLTVALSEGAAICAPSLTAGQTAPAESSFEGDVARVTLGFPKELRVKSRVLFAGASANASEAAKARVASLQSAYQKPDKRVDILLGPLGFLLKQFHAVIFPNGKPPGSNQPNPQWFWTALQRNQLPARLLSREDIETIAFIKRFSLDYGAINFINLAPNNVSELAMYYMANQILRYCDHSTYFINTLTAVIAGSRRPPSVQAAAAWAPQGGAGLEAGARALMDSLDAHPGAWTSMFASCNLLRPVMAARPMVVLGLSISKYYGMAGNDRVFQAGNWASLLGGKNACPLLIFDRTRKFVLACPRAGFVCAASSLGGGAHEHSLCEQLRGIIAEGGAAVASSVFVATVKSLGPRTQQLQIEDWLALLEDEYLSEEMMEFTTRALERGHGEWSTDAALEVAHEAEALVSQLGAAGEVFNFGDFGDADDHAASFGGLAAAAAGAAGVARKRAFHGDDPFGEGPPEKKDLTLDML

DBP

Major DNA-binding protein

1196 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

128.35 kDa

METKPKTATTIKVPPGPLGYVYARACPSEGIELLALLSARSGDSDVAVAPLVVGLTVESGFEANVAVVVGSRTTGLGGTAVSLKLTPSHYSSSVYVFHGGRHLDPSTQAPNLTRLCERARRHFGFSDYTPRPGDLKHETTGEALCERLGLDPDRALLYLVVTEGFKEAVCINNTFLHLGGSDKVTIGGAEVHRIPVYPLQLFMPDFSRVIAEPFNANHRSIGEKFTYPLPFFNRPLNRLLFEAVVGPAAVALRCRNVDAVARAAAHLAFDENHEGAALPADITFTAFEASQGKTPRGGRDGGGKGAAGGFEQRLASVMAGDAALALESIVSMAVFDEPPTDISAWPLFEGQDTAAARANAVGAYLARAAGLVGAMVFSTNSALHLTEVDDAGPADPKDHSKPSFYRFFLVPGTHVAANPQVDREGHVVPGFEGRPTAPLVGGTQEFAGEHLAMLCGFSPALLAKMLFYLERCDGAVIVGRQEMDVFRYVADSNQTDVPCNLCTFDTRHACVHTTLMRLRARHPKFASAARGAIGVFGTMNSMYSDCDVLGNYAAFSALKRADGSETARTIMQETYRAATERVMAELETLQYVDQAVPTAMGRLETIITNREALHTVVNNVRQVVDREVEQLMRNLVEGRNFKFRDGLGEANHAMSLTLDPYACGPCPLLQLLGRRSNLAVYQDLALSQCHGVFAGQSVEGRNFRNQFQPVLRRRVMDMFNNGFLSAKTLTVALSEGAAICAPSLTAGQTAPAESSFEGDVARVTLGFPKELRVKSRVLFAGASANASEAAKARVASLQSAYQKPDKRVDILLGPLGFLLKQFHAAIFPNGKPPGSNQPNPQWFWTALQRNQLPARLLSREDIETIAFIKKFSLDYGAINFINLAPNNVSELAMYYMANQILRYCDHSTYFINTLTAIIAGSRRPPSVQAAAAWSAQGGAGLEAGARALMDAVDAHPGAWTSMFASCNLLRPVMAARPMVVLGLSISKYYGMAGNDRVFQAGNWASLMGGKNACPLLIFDRTRKFVLACPRAGFVCAASSLGGGAHESSLCEQLRGIISEGGAAVASSVFVATVKSLGPRTQQLQIEDWLALLEDEYLSEEMMELTARALERGNGEWSTDAALEVAHEAEALVSQLGNAGEVFNFGDFGCEDDNATPFGGPGAPGPAFAGRKRAFHGDDPFGEGPPDKKGDLTLDML

DBP

Major DNA-binding protein

1196 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

128.374 kDa

METKPKTATTIKVPPGPLGYVYARACPSEGIELLALLSARSGDSDVAVAPLVVGLTVESGFEANVAVVVGSRTTGLGGTAVSLKLTPSHYSSSVYVFHGGRHLDPSTQAPNLTRLCERARRHFGFSDYTPRPGDLKHETTGEALCERLGLDPDRALLYLVVTEGFKEAVSINNTFLHLGGSDKVTIGGAEVHRIPVYPLQLFMPDFSRVIAEPFNANHRSIGEKFTYPLPFFNRPLNRLLFEAVVGPAAVALRCRNVDAVARAAAHLAFDENHEGAALPADITFTAFEASQGKTPRGERDGGGKGAAGGFEQRLASVMAGDAALALESIVSMAVFDEPPTDISAWPLFEGQDTAAARANAVGAYLARAAGLVGAMVFSTNSALHLTEVDDAGPADPKDHSKPSFYRFFLVPGTHVAANPQVDREGHVVPGFEGRPTAPLVGGTQEFAGEHLAMLCGFSPALLAKMLFYLERCDGAVIVGRQEMDVFRYVADSNQTDVPCNLCTFDTRHACVHTTLMRLRARHPKFASAARGAIGVFGTMNSMYSDCDVLGNYAAFSALKRADGSETARTIMQETYRAATERVMAELETLQYVDQAVPTAMGRLETIITNREALHTVVNNVRQVVDREVEQLMRNLVEGRNFKFRDGLGEANHAMSLTLDPYACGPCPLLQLLGRRSNLAVYQDLALSQCHGVFAGQSVEGRNFRNQFQPVLRRRVMDMFNNGFLSAKTLTVALSEGAAICAPSLTAGQTAPAESSFEGDVARVTLGFPKELRVKSRVLFAGASANASEAAKARVASLQSAYQKPDKRVDILLGPLGFLLKQFHAAIFPNGKPPGSNQPNPQWFWTALQRNQLPARLLSREDIETIAFIKKFSLDYGAINFINLAPNNVSELAMYYMANQILRYCDHSTYFINTLTAIIAGSRRPPSVQAAAAWSAQGGAGLEAGARALVDAVDAHPGAWTSMFASCNLLRPVMAARPMVVLGLSISKYYGMAGNDRVFQAGNWASLMGGKNACPLLIFDRTRKFVLACPRAGFVCAASSLGGGAHESSLCEQLRGIISEGGAAVASSVFVATVKSLGPRTQQLQIEDWLALLEDEYLSEEMMELTARALERGNGEWSTDAALEVAHEAEALVSQLGNAGEVFNFGDFGCEDDNATPFGGPGAPGPAFAGRKRAFHGDDPFGEGPPDKKGDLTLDML

DBP

Major DNA-binding protein

1196 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

128.315 kDa

METKPKTATTIKVPPGPLGYVYARACPSEGIELLALLSARSGDADVAVAPLVVGLTVESGFEANVAVVVGSRTTGLGGTAVSLKLTPSHYSSSVYVFHGGRHLDPSTQAPNLTRLCERARRHFGFSDYTPRPGDLKHETTGEALCERLGLDPDRALLYLVVTEGFKEAVCINNTFLHLGGSDKVTIGGAEVHRIPVYPLQLFMPDFSRVIAEPFNANHRSIGENFTYPLPFFNRPLNRLLFEAVVGPAAVALRCRNVDAVARAAAHLAFDENHEGAALPADITFTAFEASQGKTPRGGRDGGGKGPAGGFEQRLASVMAGDAALALESIVSMAVFDEPPTDISAWPLCEGQDTAAARANAVGAYLARAAGLVGAMVFSTNSALHLTEVDDAGPADPKDHSKPSFYRFFLVPGTHVAANPQVDREGHVVPGFEGRPTAPLVGGTQEFAGEHLAMLCGFSPALLAKMLFYLERCDGGVIVGRQEMDVFRYVADSNQTDVPCNLCTFDTRHACVHTTLMRLRARHPKFASAARGAIGVFGTMNSMYSDCDVLGNYAAFSALKRADGSETARTIMQETYRAATERVMAELETLQYVDQAVPTAMGRLETIITNREALHTVVNNVRQVVDREVEQLMRNLVEGRNFKFRDGLGEANHAMSLTLDPYACGPCPLLQLLGRRSNLAVYQDLALSQCHGVFAGQSVEGRNFRNQFQPVLRRRVMDMFNNGFLSAKTLTVALSEGAAICAPSLTAGQTAPAESSFEGDVARVTLGFPKELRVKSRVLFAGASANASEAAKARVASLQSAYQKPDKRVDILLGPLGFLLKQFHAAIFPNGKPPGSNQPNPQWFWTALQRNQLPARLLSREDIETIAFIKKFSLDYGAINFINLAPNNVSELAMYYMANQILRYCDHSTYFINTLTAIIAGSRRPPSVQAAAAWSAQGGAGLEAGARALMDAVDAHPGAWTSMFASCNLLRPVMAARPMVVLGLSISKYYGMAGNDRVFQAGNWASLMGGKNACPLLIFDRTRKFVLACPRAGFVCAASNLGGGAHESSLCEQLRGIISEGGAAVASSVFVATVKSLGPRTQQLQIEDWLALLEDEYLSEEMMELTARALERGNGEWSTDAALEVAHEAEALVSQLGNAGEVFNFGDFGCEDDNATPFGGPGAPGPAFAGRKRAFHGDDPFGEGPPDKKGDLTLDML

DBP

Major DNA-binding protein

1196 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

128.424 kDa

MDTKPKTTTTVKVPPGPMGYVYGRACPAEGLELLSLLSARSGDADVAVAPLIVGLTVESGFEANVAAVVGSRTTGLGGTAVSLKLMPSHYSPSVYVFHGGRHLAPSTQAPNLTRLCERARPHFGFADYAPRPCDLKHETTGDALCERLGLDPDRALLYLVITEGFREAVCISNTFLHLGGMDKVTIGDAEVHRIPVYPLQMFMPDFSRVIADPFNCNHRSIGENFNYPLPFFNRPLARLLFEAVVGPAAVALRARNVDAVARAAAHLAFDENHEGAALPADITFTAFEASQGKPQRGARDAGNKGPAGGFEQRLASVMAGDAALALESIVSMAVFDEPPPDITTWPLLEGQETPAARAGAVGAYLARAAGLVGAMVFSTNSALHLTEVDDAGPADPKDHSKPSFYRFFLVPGTHVAANPQLDREGHVVPGYEGRPTAPLVGGTQEFAGEHLAMLCGFSPALLAKMLFYLERCDGGVIVGRQEMDVFRYVADSGQTDVPCNLCTFETRHACAHTTLMRLRARHPKFASAARGAIGVFGTMNSAYSDCDVLGNYAAFSALKRADGSENTRTIMQETYRAATERVMAELEALQYVDQAVPTALGRLETIIGNREALHTVVNNIKQLVDREVEQLMRNLIEGRNFKFRDGLAEANHAMSLSLDPYTCGPCPLLQLLARRSNLAVYQDLALSQCHGVFAGQSVEGRNFRNQFQPVLRRRVMDLFNNGFLSAKTLTVALSEGAAICAPSLTAGQTAPAESSFEGDVARVTLGFPKELRVKSRVLFAGASANASEAAKARVASLQSAYQKPDKRVDILLGPLGFLLKQFHAVIFPNGKPPGSNQPNPQWFWTALQRNQLPARLLSREDIETIAFIKRFSLDYGAINFINLAPNNVSELAMYYMANQILRYCDHSTYFINTLTAVIAGSRRPPSVQAAAAWAPQGGAGLEAGARALMDSLDAHPGAWTSMFASCNLLRPVMAARPMVVLGLSISKYYGMAGNDRVFQAGNWASLLGGKNACPLLIFDRTRKFVLACPRAGFVCAASSLGGGAHEHSLCEQLRGIIAEGGAAVASSVFVATVKSLGPRTQQLQIEDWLALLEDEYLSEEMMEFTTRALERGHGEWSTDAALEVAHEAEALVSQLGAAGEVFNFGDFGDEDDHAASFGGLAAAAGAAGVARKRAFHGDDPFGEGPPEKKDLTLDML

DBP

Major DNA-binding protein

1193 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

129.835 kDa

MEDDLNTLAPLGPAAWLFVCPRQDEWCDVLAALSLCDRSSSVAIAPLLVDLTVDRDFQVAVRTPISRYEGGVLTKVTSMWPAAFVFHNAEAIVSRTEDHGDVGGLCAEARARFGVASYRAEAERADTDFTELWAALGVDGARVVMYAVVGYGLKELLYAGQLVPCVEEARTVLLGAVEAFKLPLYPATLFADGDATADGAAAVGLRSRTPFVDRRGLYVSALSEALFYYVFTALGQALRFGHTEHLIDEGMKQFLQDTQNSVKLAPQKRYYGYLSQKLTPGERDQLLLCDAIACELAFSFASVYFDSAYEPAPLMNYSEWPLVRAAEGHADLLRRLSELKLHLSAHVGALVFSGNSVLYQTRIAFFSAANKVPAGGTAQDGLLKAVQFCNGLTCLTEDALNDACRTVKFEGPGGGGGGRDEQFTPQHLAWACATSPHLMSDLVWYLNRLAIYNTGQNGGSALYEHLVHCAVNLCPACRGRCCQSCYQTAFVRIQTRLPPLPKQLKREPFVLTLFSRFLCDVDVLGTFGKRYAGDAKEPSAASLAAAPGEARKVGDEAGLGAGGGGPGGRLGVNVDRLKYFNQILDYCKRNSLIDPSTGEDTLAVRGRADFMSALSGLNRCVDEAAMALVSEVRMKSNRDEVAGATQAFNLDLNPYAVAFSPLLAHQYYRAFFLIVQNLALVSASSYVVDNPLTVSSLSRWLLQHFQSICGAFASNSARKGLLFTKDAKCSKSVEFERFMDFALYAASGRHVLLSTETKLCKLSVCMLRTCRVKNRPIPRGGKGLPVSVFFKRDVVQRRNPVRGCLAFLLYAFHERLFPGCGLSCLDFWQKVYHNALPKSVAIGKMEEFNAFVKYVLNVTTEYNEHDLIDVPPSNLLSYVEYRFHNKFLCFYGFGDYLSTLHGLSTKLVPQNHLNFPHLLAASPKFASVAEYVLYFKKLKLDGVPPPHVATFSRESLVRSVFENRSLVTVAFGIEKYSTSGGSREVFHFGQIGYFAGNGVERSLNVNSMGGGDYRYMRQRFVLATRLVDLLLRRSRRETVLFDADLLRTRVLAALESHDTQLDPELAAIAEIMDGRGGEPPEYEDVLFFVDGQECLAASIVGKIKELIKKGVEDFSLTALGADAGAGGGPAGSAGGPESGGGAGAAGGEGTYDLSALFLDVENECVVLEGPTAAALDGGGDGDECAFPAKRLRL

DBP

Major DNA-binding protein

1191 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

130.715 kDa

MDGVGKSVKLCGGPIGYIYATPKCSVPVDELAILAAKSNDCDDAVLPLVAGLTVESDFVWNVAAVAGTKTTGLGSGGTTLKLVPTHYHPCVFVFYGGDCIKPCTKAPNLTKACDLARERFGYSAYSSPAPTAFETTGQQICEALEMDAQNVMLYLVVTELFKEVIYLCNSFLHFGGSDVVTINNADVRRIPIYPLHLVLPDFNRITNEPFSEKPRALGEGAIMPKAFYNDSLCRLLHGYVLSTTAVGLRVRNIDAIARGAAHLCFDENHEGTLLPADTTFTAFTPAAETTKGQSKMGKREGSDVSGGGYERRTASLMASDATLAIENVISASVYEDPIPDVNKWPIYCNPVGYADRIEALSAYMARVAGLVGAMVFSSNSVIYMTEVGEAGSTEGKETSTTAPSFYRFFQIAAPHLSANPLVDRDGKPVSGENLSKSTSASQSEYSLDYLILACGFCPQLLARFLFYLERCDGGAKACHHDLDTVKFVSSAIDADMPCELCDKTSRIYCAHTTIKRLVYRLPKFGYQMRGAMGLFGAMTNNYCDVNALGSYAQFSTLKRSEGEASRSVMQDTYRLTVERMMKALEKEGLLTCDDPTNMASADANIRDGNSFIRAISTMKNIIESEASQLMRNLTEIREYNIREGLGDANHTLSLAVEPYASGICPVLAFLSRRTIIAVVQDMALSQCSIVMQGQQVEARNFRTQFQAVLKRRVLELQNAGFITSKTITVTLEDQQICVPDPSKSQYDSVISNMEGDLVKVTVEIFRELKVKNKVLFGGGIAGAASEATKSRLAGMVEAYQRPTKTMHVLNGPLGFAVKRYHTLLFPDVKMPNGATPNALWFWILLLRNQLPAGILSKEEEDKSLFIKKFTKSYADMNYINISPTCFGDLAQFYLANTILKYCSHKHFFINTISALVAVSRRPRDPAIVLPWIERPITKGQDVAPAAQQLIASMSDHKDIWCATFSSTNLVGSIMTTKPFVVIGISISKYHGMAGSTKVFQSGNWGNIMGGRNVCSLMSFDRTHRYVMTCPRVGFVAEQPIFSSGIKETTLIDRVRMVLSEESAAPHAAVYMLALKMVGDRVRQMELEDWMEITNDEYISSLIDELNKQVEEAEGGWNADAAMTLAKEMVNMAMSIPTDGPTFDFDACDENLEGHADGQTISETNLKRPNMNVFDLEPIPEKRVPVLSVDML

DBP

Major DNA-binding protein

1191 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

131.641 kDa

MADDDLSSLAPVAPAVWMFFLKKTRELADIVAAMSLCDKATPVVIAPLLIDLTVDRDFCGAVRTPMSTYEGGVLTKVTSFCPFAFFFHNTDEILDVVEDHGDVVHLCDDARRRFGVQAFSPLANRDRTDVDVLCDELGIAPAEYTGHVVCGNGLKELLYAGQLIPCPEEAVKVQVGAVDGVKVPLYPYTLFSGGADAAHADGPSAAVACDDPWVLEHGFYDPALSEALFYFMFTSWGQSLRVCETSRLIEAGLQQFVEDTQQTVKLTPFKKYHGYTSQKLTAVERDQLMTVDAVCSELAFSYASIYLDSVYEFSTASNFLEWPLVKNAKTHADLLDNLRDFQLHLAKHIAALIFSSNSILYQTRIVFVPSAGKGANSNPSAQDSLLKSIRFFNGLTGMYDDILNDAKKTIRFEGAVGRDEKYSPHHLAYFCGTSPQLFSTLMWFFNRMSIYSTGVTSGDTVFSHIVNAGSKLCGACGGRCCHTCYATSFIRVNTRLPGIPKQIKKEPVVVTLLSRAFADADLLGNYGKRYGLESREAGDGGGGGAGGRTDEVAAGPPAGGASGLNFVSVDRMKYLGQVLDYCKKNSLIDAITGEDIINVRTKRDFVATVTALNQTIDDAVCRFAMDVRRSGHGRDEISGSTQSFNLDLSPYATAFSPVLSFQYYRTMFSIIQNLALINAASYVVDNPLTTAQISKWVTLHFQSICGAFGTTPLKKGFLNVKDTKNLKSVEFERIMDFRSFQETGRYRKISTEIKSCKMSVQSLKSCRIKNRPISKTPQSSVFFKKGALQRKNPIKGCLSFLLFRCHEKLFPRCGLSCLEFWQRVLQNSLPRSVNVGKVEDFDNLVRFLLTVTDDYDESDVVDIQPDCLLSYVENRFHNKFLYMFGFRDYMSTIQGMSTRLTPQNHSQFPCLLKDAPKFASIAEYVLHFKKMKLDGVKAPQVATITREPVLKKLFDGRSLVSVSFAVEKYSSSMGTRDVFQFGQIGYYVGSGVDRSLNTGSMGTQDYRFMRYRYIIATKLVDVLIRRSRRENVMYDRDVVRSRVLAALDSTGLDVDPELAAIAELMEGRDEGDIPEIDDILFYVDQQEYIARSMYRKMRSLAERGVTDFSLASLREATATNATAAGSAAGGGGSATEGGGGGAAADESGPMYDFSALFSRRDEAEDVNAGLINGDDVRGDDEFELPSKRSRL

DBP

Major DNA-binding protein

1188 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

127.868 kDa

MESGGVETTRQGKTESLQYAVGPMAYVYARSNLTIDPEEWGLLCAKSSDQPSTAVAPLIPGLTVEEAFNTSIAAIIATKSSGMVGGAASAILSPCHFSPSVYVFYGGERINATSLAPGLTALCDEARTKFGFSSPPPGGPVSNAKETSGETICAALDMDPETTMLYLVVAEPFCEAVYMCNTFLHFGGADSVYINSEFVRRVPIYPVQMYMPDIALRLCRNPFDTNSRNIGEGCAYPKPLYNKSLNRVLHGAVLAPQGQSLRTRDLEAVARAATAVAFDGNFEGCVLAADKTFTQPATPQAKSAAQKPQADVERRAACSLAADLALTTRVSVSCAPYKFEGNASAPYCQWPMFCDAKTPDERAAALSKFMAELAGIVGAGFFAVNSPLYASEVVDGGAAADPGDKHASSNLTRFFFACGLHTLGCPTVDYAGNRVSDGTGDCALASASGFEYGPEHLAYACGFSPELTARALFYLERCSRYQLGADCRGGANTLKFVAAETTMAAECRWCTETTRQYCVRHTLHRLRSRLPTPRAPRRGPMAVFGAVDAEYTDCDQLGNFAPYSHMKRAGEGDSARNVMNDTYRGLCGRVMQFLVSEGLVRADTGEDARNIQSAKDLCDTYDRISNMVDEECAKFIAALSGARGYHYKEHLASSAHTFAVSLNPYSTSFCPMLSHLVTQTKSIILQDLILSQVPSTFDKGQPETKMFRSAAMPTLRSAFMGMLDKGFVSGRQEPVVVSASSVTAPDTSVPSTEKSVAQYEYSLTRGQVLKLKEFKVKNRIVFNGFEGRRGGVRMQGMADSFSRPASVKHINILGGPLGFLLKRYHEMIFGPENNVFQFWNKVIGGTMPMSHLTPEIRKTLNYIRRVSKAYAESNYVKAQPQTILELANFMVTNKILEYCGHGGTNGSFYISTPSAAVMSATRNKDPSAELAWLPAVANPTTKNLTEAAEKSIASEPEKNWVSTSMVTNACRLVMGTKPIIGLGIMVSKYIGQQSSTTVFQAGNWSGFMGASGIQSVNAGLSGDTTRKCMLACKRTGALIKAGPSSSFTESSLAGQVRSMVEAGCTPHAIYAVALRVLGEGLRDVTTDTWVAIVEDRFLIEALEELHAQIAASTPNGWTHEAAMAELNKHGNEEVATDGEMLNFDCDDDDADKDAPHGAKSDVPNGDDEDVFAGPSAKKRTLATEILFC

DBP

Major DNA-binding protein

1186 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

127.287 kDa

MENKQKTATTVKVSPGPLGYVYARRLPPEGLTELALLSARSADSDTAVLPLIAGLTVESGFDVNVAVVVGSRTTGVGGTGVSLKLMPSHYAPSAYVFHGGRHLAPSSAAPNLSLLCDRARVQFGFSSFKPKPCEAEGETTGEALCEHLGLNPNESLLYMVIAEGFKEAVYISNTILHMGGVGTVTIAGEEVRRIPIYPLQMFMPDYCRAVADPFNDRHRAIGEYFAYPLPFFNAKLASLLFGAAVGPAAVALRARNVDAVARAAAHLAFDENHEGAALPADITFTAFDPTGSKAGHRNPRECGGGFEQRLASVMAGDAALALESIMSMAVFEEPPTDIGTWPMLTCQESTAARAASIGAYLGRAAGLVGAMVFSSNSALHLTEVDDAGPADPKDPTKPSFYRFFLVPGTYVAANPQLDRDGRVVAGHEGRPIVPIVGGNHEFTCEHLATLCGFSPELLAKMLYYLERCDGGVILGRPEMDTFKYVSDSAHTDVPCCLCSLDNRHSCAHTTLLRLRARHPKFTSTTRGAIGIFGVMNSAYSDCDVLGNYASFSAIKRMDVQETARAIMQETYRSAVERVMAELENLNYIDAAVPTSPAKLESIITGREALQTVVSNVKQVVDGEVAQLMRALVEGRGFRFREALGEANHAMSLTLDPHASVPCPLLQMLGRRSNLAVYQDLALSQCHGVFEGQAVEGRNFRSQFQPVLRRRVLDMFNNGFLSARTLTVALTDGACISAPGLVSGQHAAAESGFEGDVARVNLGFPKEIRVKSRVLFAGAGPAASEAARARIAGLQSAYQKSDKRVDILLGPLGFMLKQFHATLFPNGKPPGSDNPNPQWFWTALQRNQLPARLLSREDISLIAFVKRFSVEYGAGNFVNLPPNNISELAMYYMANQILKYCDHSTYFINTLTALIAGSRRPPNAQAAAAWAPRGGTELEAQARSVVANPGDHPGAWTTMFASCNLLRPVMATRPMVVLGLSISKYYGMAGNDRVFQAGNLANLLGGKNACPLLIFDRTRKFVIACPRAGFVCAAVSAGSGAHESSLCEQLRAIIAEGGATVASDVFAAAAKSLGARVQQLQIEDWLALLEDEYLSEEMMELAGRALERGGGEWSLDAALDVAREAEAMVTRHVDAEETFDFGAFAEDGPADAGLAVHLQSRRRPLACSDLFGDAPAEKRNDLTLDML

DBP

Major DNA-binding protein

1175 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

125.351 kDa

MEAAAKTVTVRAAPLGYVYVTPIEALRRDLLALLVARSADDAAAVAPLVRGLTVEAGFAGHVAVVAGARTTGLGGGLTLKLTPNHFHPNVFFFHNGDCVPPSSAAPALSRACEAARARFGFSAYRTPVDNAEETTGAEVCARLGLAADAHAAYLVVADGFKEAVYLCNAFLHYGGAGTVSINGHEAWRVPLYPVHLFMPDVNRLVADPFNAKNRSISEEFVYPRPFFNGPLCRLLHGYVLGPAAVATRVRNLDAVARGAAHLAFDENHESAVLPADVTFTLFEQRRRGGDAAAGGLERRMASVMSADAALSLEALVAAGVYDEEPPALDDWPVLSEAGAKDGGAAAASAGAPVSQAAALGAYVSRAAGLVGALVFSSNSVLYLTEVDDAGAADARKEGAGPSFNRFYQVAAPYLAGNPQTDKDGRVLLHTASQPATAPGNHDFAMDHLVMACGFCPQLLARVLFYLERCDAGTFVGRGDVDAVRYVAGSLDAEVPCSLCDRASRPACAHTTLHRLRHRSRASARRRSPMGVFGTMNSAYSDCDVLGNYASYGALKRPNDSEPPKAIMQDTYRAAVDRLLADVAGARIGETVTDHAGFRHALRALRDTVEQAADRFVRTLVETRDFKLRDALYDANHTMSLSLDPYSGALCPATSFLARRTLLAVLQDLALSQCHGVLHGQPVEGRNFRNQFQPVLRRRVVDMLNGGFVTAKTVTVTLADGIVAPDPTKGSAEPPARDHDGDLARVSFEVLRELRVKSRVMFSTGSGSLSDAARARVAGLAGAYQRPDTAVDVLNGPLGFLLKQHHATLFPRGKPPGGQSPNPQWFWTLLQRNQLPARLLTKDDIETIAAVKRFSVDYGAINYVNLTPGTVAELAQFYLANLILRYCDHKQFFINSLTGITMQSKRPRDPAAVMAWVRRPLADAADAERAAREVLDAPRDDTWVATYTSSHLLRSVMASRPLVVLGLGVSKYHGMAGNNRVFQAGNWSGLNGGKHVCPLMVFDRTRHFVLACPRVGFTCSQTGGGAGLHDHSLGEHVKTILADGGPLVQTAVYAAVLHALGARTQHLEPDDWRAIVDDEFLAAALAEINGRVADRDGRWSVEAAAELVRDLEGQTGADGGEETAFDFGACGAGGDVAGLAPASLVPAELGGKRPPPEDDLFDMGAPPEKRLTFDML

DBP

Major DNA-binding protein

1160 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

129.006 kDa

MSNEELSALAPVGPAAYVYFTKTNHEMNEVLATLSLCDSSSPVVIAPLLMGLTVDQDFCTSVRTPVVCYDGGVLTKVTSFCPFALYFYNTQGIVDFSEPHGDVQRLCDETRQRYAIESYMPEEGRAPTDLAALCTAAGCDPQEVLVHVVVGNGMKEFMYAGQLIPCFEEAAPTRLNDCDAVRVPLYPPTLFGSLQADVDSDELSLDKRSSFVESRGLYVPAVSETLFYYVYTSWCQALRFSETKVLIEAALKQFVNDSQQSVKLAPHKKYFGYTSQKLSSLEKDHLMLSDAVICELGFSFASVFLDSAYGASDSMVYSEWPVVVNATDHRDLIRALTELKLHLSTHISALLFSCNSILYHNRLVYLTSNKNASGTGASQEVLLKSIHFANGLTGLCEDTYNDARKLIKCSGVVAKDERYAPYHLSLICGTCPQLFSAFIWYLNRVSVYNTGLTGSSTLSNHLIGCSSSLCGACGGTCCHTCYNTAFVRVQTRLPQMPRLPKKEPSVVVMQSRFLNDVDVLGTFGRRYSAESKEASLDAKADEGSASTSNRTASSSVDRTHRLNRILDYCKKMRLIDSVTGEDTMTINGRSDFINLVSSLNKFVDDEAMSFVSEVRMKSNRDEVLGATQAFNLDLNPFAVSFSPILAYEYYRVIFAIIQNVALITATSYIVDNPLTTSLVSRWVTQHFQSIHGAFSTTSSRKGFLFIRNVKSSKNADHDRLPDFKLYARGTYSVISMEIKLSRLSVPSLLMFRVKNRPISKASKGTTAHVFFRREHVPKKNPVKGCLGFLLYKYHDKLFPDCGFSCLQFWQKVCANALPKNVNIGDMGEFNNFVKFVISVTADYNEHDLIDVPPDCMLNYLENRFHNKFLCFYGFKDYIGTLHGLTTRLTYQNHAQFPYLLGESPNFASAADFALRLKDLKATGVTAPLASTVTRESLMRTIFEQRSLVTVSFSIEKYAGVNNNKEIYQFGQIGYFSGNGVERSLNTNSIGGQDYKFMRQRCILATKLSDVLIKRSRRDNVLFDEDIIKNRVMAALDSENLDVDPELMAMYEILSTREEIPERDDVLFFVDGCQAVADSLMEKFSRLQEMGVDDFSLVNLQQVLDSRPECGGGGGEVHDLSALFTAASGEAVGNSVGLNARGGEHAFDEDCGLLPAKRGRL

DBP

Major DNA-binding protein

1145 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

126.491 kDa

MNSNRAAAGPVEENVGTQASVGPCGFVYLYPGDTFPVEEASLLGNLHAGGEVFSLPLLSGLTVEADFHVNVKAVHKKLDPATVSVKASAYHREVIVFANAACFKPIFAGPGLEGLCAASRQLFGYAEFEERAGGAARPFELADLGHLLPGAESHIAGVVVTESFKERLYRGQLVVVESQIQSVRVGECDAFKVPLYDGELFAKSPCRENLRYFYHAGVSRYLFEAHYTSLAQALRVRDVPGLIGALERQSFHDQYKLPKVYECREFPATGHRGAGDCSLTIVDSVATELAVSYGLSFLEVPQEGTALLSYDKWPIFEGCETPEQRVEALTQFNAKQAVHVHSQLFSGNSVLYLARVQKQASNRGGGGENVYNSFFMGHGLACLAEPTQKENGLPSFPGVPASALSGSNYSLHHLAYAASFSPQMLARHCYYLQFAQHQKSSNNSGYNVPTYVGTAANTPMCELCRGSCPASCVNTLFYRLRDRFPPVVASVRRDPYVVTGVAGAYNDLDIAGNFANYRDKDEESNQSEEREKFTYWQVTQTVLERLSEAGICEGGEDVGDAIHNIGSFLKVFKEIDGIVDGEVARFINSMVKNNVNYRESIKSIHHIVQYVCNVYWQPPCPVFLNLYYRCVLAVVQDICLPTCMMYEQENPAVGVSPGEWLKMHYQTLWTNFKNSCIDKGVLTGTEYKVVHKDQFCDFFDVDSAARGEFVSCKTQVRISRALMMAPRVMKIKNRIIFSNSPGTESIQNAFVRGTPKGDSCVVSGPYMRFLSTYHSQLFPGAKISPLFLWHTFSKKRQLPVFPNVPRESVTELANYVEQNSRLHGETSIIDVVPENFYTYAKVRLNNALFRACGQTQFYATTIHCLTPKIQTVPAEEYPHALGARGVADVGEYLGAARELTVPTVQCTSRDNICEVGKCRPIVTLPLVVNKYTGVTGNSQIFQCANLGYFIGRGVDKNLIPDAGSFKKQGVSTSMRKRHVFMTPLSDHLLRRSVQGAAVAFEIEGVRRRVQQILSDGDNPHVIRDVVLQLVKSLGSECRSVSEYDLEYYMGQYYIFAGDVSERLQRLSDLGGDWSEEWALSVLGEEEDPLGGELEFEKVEDAECLGHPQQDEFALAPQAAAPQYSGSSSVAGKKRKANVILGDLDL

DBP

Major DNA-binding protein

1143 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

130.078 kDa

MSSDDNNIASSASSGHGAWIYITEKTPDVLDILNRLVLTSADSDVTIAPLLYDVTVEPGFELTVKCPLMLTDNNVILKLSNFMPCVFIINSTSSEDFRFCEDVVGNVSEICEGAASRYGYTADFTEFNERTETTDSDVCSNVNVPESDYFVYIACTYGYKELLFKGYLIPHWQDLRDISIGNRRGYKIPLLSPFLFTQCKDDTVQLTDQFILDNGFYNPDLTKTLYSYIFRPLAVSLRYLDVTHLISVTLNQYITDTHATAKLCDKKVYTCHGNNKLSTGDRDVLALCDILANEVTVSYLTPFLDSAYDAPSTLDFYSWPIVKDKTHAEILENLDQFLLHMSVHIGTLIFSGNSVLYQNKISKVGGQSDGSNGQSVEGLLKSIYHTTGIQLLYEDGYDDTRSLVRQHTAKPKNLKFNMDHLSFGASFSSHVLTKIVWFLNRSEEYKTTQSVSSTCYLVINSSTGTCTACDGKHCNTCIGALMCRMATRFPNINRQQKKEPCVTTLLTRMFADMTILGSFGKKYNTERDTQQKDGRVSAEPLDKAKYVLNILDYCKRECLIDSDGNDTLKISSKQEFIKIITGLNRTIDDELIKLLSDMRKHSNAKDDLNNSTMSFTLDLNPHAYAFSPLLQFVYMKTLVNILESLAIVVIAEKISSYPMTQSAYSRWVKQHFQSVYSEFKKSIYKKGFLTLSDYKMKNTTTNDTFTDFSHLKRDYKIDNTVRSSIATVNYQCRLWNFHVSSLRDFRIKYKPIPKNKDSPYFQKADKGIQNPVCGPLSFLITRFHKDIFPNVNVSPMTLWQRIYSNTLKNFNVDLGDKHDVETFIKFMFEQTVEYEGSNSIDVRPETILQYIEFRFVNRLLHASGHRGQYIGIVQALCTTLSDTKVDGLPCYLDSSRTFGTVSEYHAYCREYNGTVKVGRTRPYCNTNGMFERRPLVTVPYALEKYTGAAGNASIFQCGQLGYFSGTGIDRNLGMINRTSDYNFMRRKHIFCTPLTDVLFTKISRGAHVFDFDMLKQRIKQLLDEHCGGFDIELAILSEILKHVKEPNYNDLLFITGYQEHIASSLFDKIKVLDELEISSYSIESLQEIFPEKEELNDTEATGSGYDFSFIIPKATDVDEITGLNIQEFTNIEDETPLVKRMRL

DBP

Major DNA-binding protein

1132 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

127.763 kDa

MADENETVVSAPVSTAAWIYVFPKDKELLDVLSVLSLMERNSPIVISPLLMNLTVENDFSTTVKTPITNFGGTILTKITSFMPVCFFFHGTEQLVGMAEDHGDLIRLCEQTRQKFHLQSFEVPTARKVIDIKALCSAVGKDADSVICHVACGNGFKELLFAGLLIPCVEEQIQVQVGEYSCVKIPLYSATLFETEETISLSSCTEFIQERGFFLPALSETLFYYVFTSWGTTLRFSNTKELIDAGLKQFTQDGEQTVKLAPHKTYLGISGQKISAVEKDFLMLVDSVVTELSFSHVAEYLDSVYDPSQIMNFNDWPIIRNSETHAERMAQLTNLKLHLSSHLAVLIFAPNSILYCSKLAFIPNVKQAFNSVMTQELLLRSLSFCNALSSLSDDVYNDNRKIIKCDSTSGKDDKFSANHLAYACATSPQLLSFVVWNLNRMSVYNAGNAHTEIYNHLVNCSANLCEFCDGKCCQSCIGTAMVRVGTRLPAIPKNVKKEPLVMSMFSRYYAEVDILGSFGRKPVSELKEIGKDQQNTLSLDRGKFVSQIFDYCKKNSLIDPVTGEDTFNVRSKKDFVSIIHGLTQCIEECVSRCIVEMRRTQTPREQIENCLQSFNVDTTPYATAFSPFLTFSYYKVILTVLQNLALIVASGHVVDRPCTGNSISKWLVQQYQSLYGTFHSSYLKKGFLNTRTVKVASNVDMEQILDCDLYKSGKYVKTTIQAKLCRLSMQCLRDFRIKNRPFNKSSKTAHNNPYFKKNVKHKKNPLSGCISFLLFKYHDKLFPNVKISCLELWQRFLLNNVPKTLDIGNPEEVKTFIKFAFSITNTYDEIDIIDIQPECLSTFIDCYFHNKFLSALGFHDYLTSLHGLTSKLVTQNPVLFPVVLDKQPKFSSIQEYLVYVKKLVLDGVPNPVIASLSKEPNFGTIFTSRSLVTFGLTLEKFVSLANREYFQFGQLGWIGGSGVDRNLNPTSSALQDFRFMRQKTIIATKFSEVIVKKVRREAIMFDTEVVKGKVLSIVENLTNDIDPELLIIAEVMRDREDKPTMDDMLFFVDGREALAASIMLKLNHLVDMNVKDFSITNLQSVFETVSSNDAPVYDFSEILAEEDDQGNGVLKCDETETETDEPMTKKNRL

DBP

Major DNA-binding protein

1132 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

127.818 kDa

MADENETVVSAPVSTAAWIYVFPKEKELLDVLSVLSLMERNSPVVISPLLMNLTVENDFSTTVKTPITNFGGTILTKITSFMPVCFFFHGTEQLVGMAEDHGDLIRLCEQTRQKFHLQSFEVPTARKVIDIKALCSAVGKDADSVICHVACGNGFKELLFAGLLIPCVEEQIQVQVGEYSCVKIPLYSATLFETEETISLSSCTEFIQERGFFLPALSETLFYYVFTSWGTTLRFSNTKELIDAGLKQFTQDGEQTVKLAPHKTYLGISGQKISAVEKDFLMLVDSVVTELSFSHVAEYLDSVYDPSQIMNFNDWPIIRNSETHAERMAQLTNLKLHLSSHLAVLIFAPNSILYCSKLAFIPNVKQAFNSVMTQELLLRSLSFCNALSSLTEDVYNDNRKIIKCDSTSGKDDKFSANHLAYACATCPQLLSYVVWNLNRMSVYNAGNAYTEIYNHLVNCSANLCEFCDGKCCQSCIGTAMVRVGTRLPAIPKNVKKEPLVMSMFSRYYAEVDILGSFGRKPVSELKEIGKDQQNTLSLDRGKFVSQIFDYCKKNSLIDPVTGEDTFNVRSKKDFVSIIHGLTQCIEECVSRCIVEMRRTQTPREQIENCLQSFNVDTTPYATAFSPFLTFAYYKVILTVLQNLALIVASGHVVDRPCTGNSISKWLVQQYQSLYGTFHSSYLKKGFLNTRTVKVASNVDMEQILDCDLYKSGKYVKTTIQAKLCRLSMQCLRDFRIKNRPFNKSSKTAHNNPYFKKNVKHKKNPLSGCISFLLFKYHDKLFPNVKISCLELWQRFLLNNVPKTLDIGNPEEVKTFIKFAFSITNTYDEIDIIDIQPECLSTFIDCYFHNKFLSALGFHDYLTSLHGLTSKLVTQNPVLFPVVLDKQPKFSSIQEYLVYVKKLVLDGVPNPVIASLSKEPNFGTIFTSRSLVTFGLTLEKFVSLANREYFQFGQLGWIGGSGVDRNLNPTSSALQDFRFMRQKTIIATKFSEVIVKKVRRETIMFDTEVVKGKVLSIVENLTNDIDPELLIIAEVMRDREDKPTMDDMLFFVDGREALAASIMLKLNHLVDMNVRDFSIANLQSVFEAVSSNDAPVYDFSEILAEEDDQASGVLKCDETETETDEPMTKKNRL

DBP

Major DNA-binding protein

1132 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

125.409 kDa

MALKGPQTLEENIGSAAPTGPCGYLYAYVTHNFPIGEASLLGNGYPEAKVFSLPLLHGLTVESDFPLNVKAVHKKIDATTASVKLTSYHREAIVFHNTHLFQPIFQGKGLEKLCRESRELFGFSTFVEQQHKGTLWSPEACPQLPCANEIFMAVIVTEGFKERLYGGKLVPVPSQTTPVHIGEHQAFKIPLYDEDLFGPSRAQELCRFYNPDISRYLHDSIFTGIAQALRVKDVSTVIQASERQFVHDQYKIPKLVQAKDFPQCASRGTDGSTLMVIDSLVAELGMSYGLSFIEGPQDSCEVLNYDTWPIFENCETPDARLRALEVWHAEQALHIGAQLFAANSVLYLTRVAKLPQKNQRGDANMYNSFYLQHGLGYLSEATVKENGASAFKGVPVSALDGSSYTLQHLAYASSFSPHLLARMCYYLQFLPHHKNTNSQSYNVVDYVGTAAPSQMCDLCQGQCPAVCINTLFYRMKDRFPPVLSNVKRDPYVITGTAGTYNDLEILGNFATFREREEEGNPVEDAPKYTYWQLCQNITEKLASMGISEGGDALRTLIVDIPSFVKVFKGIDSTVEAELLKFINCMIKNNYNFRENIKSVHHILQFACNVYWQAPCPVFLTLYYKSLLTVIQDICLTSCMMYEQDNPAVGIVPSEWLKMHFQTMWTNFKGACFDKGAITGGELKIVHQSMFCDLFDTDAAIGGMFAPARMQVRIARAMLMVPKTIKIKNRIIFSNSTGAESIQAGFMKPASQRDSYIVGGPYMKFLNALHKTLFPSTKTSALYLWHKIGQTTKNPILPGVSGEHLTELCNYVKASSQAFEEINVLDLVPDTLTSYAKIKLNSSILRACGQTQFYATTLSCLSPVTQLVPAEEYPHVLGPVGLSSPDEYRVKVAGRSVTIVQSTLKQAVSTNGRLRPIITVPLVVNKYTGSNGNTNVFHCANLGYFSGRGVDRNLRPESVPFKKNNVSSMLRKRHVIMTPLVDRLVKRIVGINSGEFEAEAVKRSVQNVLEDRDNPNLPKTVVLELVKHLGSSCASLTEEDVIYYLGPYAVLGDEVLSLLSTVGQAGVPWTAEGVASVIQDIIDDCELQFVGPEEPCLIQGQSVVEELFPSPGVPSLTVGKKRKIASLLSDLDL

DBP

Major DNA-binding protein

1131 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

129.009 kDa

MADDNETVVSAPICTAAWLYILPKEQKLIEILTTLSLMEKRKSVVISPLLLNLTVENDFFPTVKTPIINYGGTVITKITSFMPVCFFFHGTDVFLKEAEDHGNLDKLCKQTREKFNLQEFVVNGNRKSVDIGKICESVGRNADDVLCHIVVGNGFKELLFAGLLIPCVEEQIQVQVGECLAIKIPLYSATLFESEETLCIDTCTEFIQENGFYAPQISEVLFYLIFTSWGMTLRFNNTLELIKAGLKQFIQDTEQTVKLAPNKTYHGIPGQKLSPIEKDHLMLVDAVITELTFSYTAEYLDSIYENNQIMNFSEWPIIKSAETHEEKIVELKKLRLHLSSHVAALVFAANSILYSNKLAYISNTKQAFNSAITQETLLRSIQFCNSLSSLNEDFYNDARKLIKCNSSPCKEDKFSAFHLAYACATCPQILSHIIWNLNRMSIYNTNCGNSEIYNHIVNCSSNLCEFCEGKCCHSCIGTALIRINSRLPQISKTTKKEPIVMTMFSRFYADVDVLGSFGKKGVNESKDPMKEAQTTPSLDRFKFLGMIHDYCKKNNLIDAITGEDNLNFKSQNDFVNMINDLIQCIEEAVSKCISEMRKTQTSREQIENCLQSFNIDTTPLSLAFSPFFVFTYYKVILIVLQNLALIIGTGYVVDRPCTGNLISKWLMQQYQSLYGAFYNSHFKKGFLNMKTVKIASNVDMEQYIDFNLFKSGKYAKTSIQAKLCRLSMQCLKDFRVKNRPFNKPNKNTQNNPFFKKVKQKKNPLSGCLSFLLFKYHERLFPNLKISCLEFWQRILLNNMPKTIDIGNVEDMRSFIKFTFRVTNSYDEIDLLDIQPECLLSFIEYYFHNKLLSVLGYRDYLTSLHALTSKLVPQNPMLFPVFLKEHPTFSSVQEYVMHVKKLVGNGLKEPMTASLTKEPNFGSIFTGRSIITFGLMIEKFVSVASRDYFHFGQLGWIAGSGVDRNLNPPSSGLQDFRFMRQKFVIATKLCDIIVKKVKREAIVYDVEVIRGKVLNIIESLSNSVNPELLILAEVMKDRDSKPTMDDMLFYVDGREPLAKSVMNKIQHLTDLNVHDFSLSTLLSVFEEQVEDSAAIYDFSELLVEGNEQGFGILKCEETEHENEEPSLKKARL

DBP

Major DNA-binding protein

1128 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

123.051 kDa

MQGAQTSEDNLGSQSQPGPCGYIYFYPLATYPLREVATLGTGYAGHRCLTVPLLCGITVEPGFSINVKALHRRPDPNCGLLRATSYHRDIYVFHNAHMVPPIFEGPGLEALCGETREVFGYDAYSALPRESSEPGDFFPEGLDPSAYLGAVAITEAFKERLYSGNLVAIPSLKQEVAVGQSASVRVPLYDKEVFPEGVPQLRQFYNSDLSRCMHEALYTGLAQALRVRRVGKLVELLEKQSLQDQAKVAKVAPLKEFPASTISHPDSGALMIVDSAACELAVSYAPAMLEASHETPASLNYDSWPLFADCEGPEARVAALHRYNASLAPHVSTQIFATNSVLYVSGVSKSTGQGKESLFNSFYMTHGLGTLQEGTWDPCRRPCFSGWGGPDVTGTNGPGNYAVEHLVYAASFSPNLLARYAYYLQFCQGQKSSLTPVPETGSYVAGAAASPMCSLCEGRAPAVCLNTLFFRLRDRFPPVMSTQRRDPYVISGASGSYNETDFLGNFLNFIDKEDDGQRPDDEPRYTYWQLNQNLLERLSRLGIDAEGKLEKEPHGPRDFVKMFKDVDAAVDAEVVQFMNSMAKNNITYKDLVKSCYHVMQYSCNPFAQPACPIFTQLFYRSLLTILQDISLPICMCYENDNPGLGQSPPEWLKGHYQTLCTNFRSLAIDKGVLTAKEAKVVHGEPTCDLPDLDAALQGRVYGRRLPVRMSKVLMLCPRNIKIKNRVVFTGENAALQNSFIKSTTRRENYIINGPYMKFLNTYHKTLFPDTKLSSLYLWHNFSRRRSVPVPSGASAEEYSDLALFVDGGSRAHEESNVIDVVPGNLVTYAKQRLNNAILKACGQTQFYISLIQGLVPRTQSVPARDYPHVLGTRAVESAAAYAEATSSLTATTVVCAATDCLSQVCKARPVVTLPVTINKYTGVNGNNQIFQAGNLGYFMGRGVDRNLLQAPGAGLRKQAGGSSMRKKFVFATPTLGLTVKRRTQAATTYEIENIRAGLEAIISQKQEEDCVFDVVCNLVDAMGEACASLTRDDAEYLLGRFSVLADSVLETLATIASSGIEWTAGAARDFLEGVWGGPGAAQDNFISVAEPVSTASQASAGLLLGGGGQGSGGRRKRRLATVLPGLEV

DBP

Major DNA-binding protein

1128 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

123.122 kDa

MQGAQTSEDNLGSQSQPGPCGYIYFYPLATYPLREVATLGTGYAGHRCLTVPLLCGITVEPGFSINVKALHRRPDPNCGLLRATSYHRDIYVFHNAHMVPPIFEGPGLEALCGETREVFGYDAYSALPRESSKPGDFFPEGLDPSAYLGAVAITEAFKERLYSGNLVAIPSLKQEVAVGQSASVRVPLYDKEVFPEGVPQLRQFYNSDLSRCMHEALYTGLAQALRVRRVGKLVELLEKQSLQDQAKVAKVAPLKEFPASTISHPDSGALMIVDSAACELAVSYAPAMLEASHETPASLNYDSWPLFADCEGPEARVAALHRYNASLAPHVSTQIFATNSVLYVSGVSKSTGQGKESLFNSFYMTHGLGTLQEGTWDPCRRPCFSGWGGPDVTGTNGPGNYAVEHLVYAASFSPNLLARYAYYLQFCQGQKSSLTPVPETGSYVAGAAASPMCSLCEGRAPAVCLNTLFFRLRDRFPPVMSTQRRDPYVISGASGSYNETDFLGNFLNFIDKEDDGQRPDDEPRYTYWQLNQNLLERLSRLGIDAEGKLEKEPHGPRDFVKMFKDVDAAVDAEVVQFMNSMAKNNITYKDLVKSCYHVMQYSCNPFAQPACPIFTQLFYRSLLTILQDISLPICMCYENDNPGLGQSPPEWLKGHYQTLCTNFRSLAIDKGVLTAKEAKVVHGEPTCDLPDLDAALQGRVYGRRLPVRMSKVLMLCPRNIKIKNRVVFTGENAALQNSFIKSTTRRENYIINGPYMKFLNTYHKTLFPDTKLSSLYLWHNFSRRRSVPVPSGASAEEYSDLALFVDGGSRAHEESNVIDVVPGNLVTYAKQRLNNAILKACGQTQFYISLIQGLVPRTQSVPARDYPHVLGTRAVESAAAYAEATSSLTATTVVCAATDCLSQVCKARPVVTLPVTINKYTGVNGNNQIFQAGNLGYFMGRGVDRNLLQAPGAGLRKQAGGSSMRKKFVFATPTLGLTVKRRTQAATTYEIENIRAGLEAIISQKQEEDCVFDVVCNLVDAMGEACASLTRDDAEYLLGRFSVLADSVLETLATIASSGIEWTAEAARDFLEGVWGGPGAAQDNFISVAEPVSTASQASAGLLLGGGGQGSGGRRKRRLATVLPGLEV

DBP

Major DNA-binding protein

1128 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

123.034 kDa

MQGAQTSEDNLGSQSQPGPCGYIYFYPLATYPLREVATLGTGYAGHRCLTVPLLCGITVEPGFSINVKALHRRPDPNCGLLRATSYHRDIYVFHNAHMVPPIFEGPGLEALCGETREVFGYDAYSALPRESSKPGDFFPEGLDPSAYLGAVAITEAFKERLYSGNLVAIPSLKQEVAVGQSASVRVPLYDKEVFPEGVPQLRQFYNSDLSRCMHEALYTGLAQALRVRRVGKLVELLEKQSLQDQAKVAKVAPLKEFPASTISHPDSGALMIVDSAACELAVSYAPAMLEASHETPASLNYDSWPLFADCEGPEARVAALHRYNASLAPHVSTQIFATNSVLYVSGVSKSTGQGKESLFNSFYMTHGLGTLQEGTWDPCRRPCFSGWGGPDVTGTNGPGNYAVEHLVYAASFSPNLLARYAYYLQFCQGQKSSLTPVPETGSYVAGAAASPMCSLCEGRAPAVCLNTLFFRLRDRFPPVMSTQRRDPYVISGASGSYNETDFLGNFLNFIDKEDDGQRPDDEPRYTYWQLNQNLLERLSRLGIDAEGKLEKEPHGPRDFVKMFKDVDAAVDAEVVQFMNSMAKNNITYKDLVKSCYHVMQYSCNPFAQPACPIFTQLFYRSLLTILQDISLPICMCYENDNPGLGQSPPEWLKGHYQTLCTNFRSLAIDKGVLTAKEAKVVHGEPTCDLPDLDAALQGRLYGRRLPVRMSKVLMLCPRNIKIKNRVVFTGENAALQNSFIKSTTRRENYIINGPYMKFLNTYHKTLFPDTKLSSLYLWHNFSRRRSVPVPSGASAEEYSDLALFVDGGSRAHEESNVIDVVPGNLVTYAKQRLNNAILKACGQTQFYISLIQGLVPRTQSVPARDYPHVLGTRAVESAAAYAEATSSLTATTVVCAATDCLSQVCKARPVVTLPVTINKYTGVNGNNQIFQAGNLGYFMGRGVDRNLLQAPGAGLRKQAGGSSMRKKFVFATPTLGLTVKRRTQAATTYEIENIRAGLEAIISQKQEEDCVFDVVCNLVDAMGEACASLTRDDAEYLLGRFSVLADSVLETLATIASSGIEWTAGAARDFLEGVWGGPGAAQDNFISVAEPVGTASQASAGLLLGGGGQGSGGRRKRRLATVLPGLEV

DBP

Major DNA-binding protein

1128 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

127.458 kDa

MATKTAQPSADNLGSRAPVEPCGYIYVYPKEGFPFKEASLLGNKNVGASAMSLPLLSDLTVESNFSFNVKAVHKKIDMTTLLVRVSAYHREAIVFFNTDLFEPIFVGPGLDILCSDARSLFGYTNFVPRTDLRDTVDIKDLYAPFYSEDSCFMAVVVTEGFKERLYFGNLVPIIAQGLKVQINGREAVKIPLYDEDLFSKSHEHLPRFYIPSVSKYLHDSVFTSIAQALRIRDVESVIRASEKQSIQDQYKLAKIVNSKDFSLQSVKCQDASAFMVIDCIAAELAMSYGLSFLEAPQDPCAVLDYTSWPIFETAETEEDRIKAIQDWNAMMSVHVYTHLFSTNSVLYLTKINKQTQSNKSEQNVYNTYFMQHGLAYAADATQRENGEPAFSGAPKFSGGTYTLYHLALASSFSPHLLARNCYYMQFCQHQKSTTNANYSVPQYVGTAAASDLCELCQGTCPASCIHTLFYRLKDRFPPVLGSQRRDPYVVTGVSGQYNDLDMLGNFATFREKEDEAVQNAESEKYTYWQLIQNVVEKLSTMGVTEGTVGSELITDIQSFLKTFRDIDNVVDSEVVKFMNCLVKNNINFRETIKTVHHVLHYCCNVFWQAPCAMFLNLFYKSVLAIIQDICLPIAMTYEQDNPSIGMMPSEWLKVHYQTIWTNFKSSCLDRGVLTGSEHKIVHTDMFCDFLNIDSALSGQIVPMKMQVRLAKALLTVPKTIKIKNRIVFSNSSMTETIQSGFIKSATKKDSYIVTGPYMKFLNSLHKVMFPNAKISALYLWHTFSQKKQLPVLPGISRENMVELANYVETSSKMHDDMNVLDIIPTTLLTYAKVRLNNTILRTCGQTQFYATTLQCLLPTLQTISATEYPHVLLDQSIMSVDHYLSSIKDKHALTVQTTLKEDIATVGKQRPIVTVPLVVNKYTGINGNTQIFQCGNLGYFMGRGVDRNLIPDSTGFRRQNNSSYMRRRHVFMTPMVAHLVKKNSNLNNLTFEVETIRKNVQNIFEDKDNLNIFDNVVLELVKGLGDSCENITEDDLQFYLGEYYIMSDEIWSRFQIITDSGAPWSVENVTKVLGCNKQEECKFEFVGVEEQLSCVPPQIEEFAPQATLSTLAASRKRKITSILSDIDL

DBP

Major DNA-binding protein

1127 amino acids

Plays several crucial roles in viral infection. Participates in the opening of the viral DNA origin to initiate replication by interacting with the origin-binding protein. May disrupt loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation. Promotes viral DNA recombination by performing strand-transfer, characterized by the ability to transfer a DNA strand from a linear duplex to a complementary single-stranded DNA circle. Can also catalyze the renaturation of complementary single strands. Additionally, reorganizes the host cell nucleus, leading to the formation of prereplicative sites and replication compartments. This process is driven by the protein which can form double-helical filaments in the absence of DNA.

Belongs to the herpesviridae major DNA-binding protein family.

126.887 kDa

MALKHQLNHAVEDNLGSKAPIGPCGFIYIYPETHFNFKEISLLGDKYAEAGAFSLPLLHGVTVEEAFVPNVKAVYKKIDMTTVSVKLSTFYNRAIIFHNVEKFESIFSGPGLGSLCKEACDLFGYVPFTPLGEGSTDVSDICPPVWQEKDAIMAVVITEGFKERLHLGKLIYLKSQMHSVMINKTEVYRIPLYDEDLFTKKSSLRRLYLPAVSEYLYYTLYTSLAQSLRVHNAASLVEAIQEQFVHDKYKMAKLVSFKEYPLATVGACDTTLMVIDAVAAELGLSYSLSFFEAPQEKTKVQDYYSWDIFASCETDSDRLEALSKWNALQAIHIHAQLFSTNSIYYVNRVARQAPIPNSKVEPNVYNSYYLQHGLANLCEETLFEDGSPAFTGAPASSLDGSSFTLQHLAYAAAFSPNLLARMCYYLQFCQHQKSTLNPAYNITEYVGSAANSPVCSLCSGQCPCVCINTLFYRLKDRFPPVLQGSRRDPYVITGITNVFNELDFLGNFASFRDKDEDQNQTEETPRYTYWQLNQTLTEKLEAAGLVDSPVADEGAGGSGSMNLEKFVRTFSDIDSLVDAEAAKFINTMIKNNVNFKESIKGVSHVIQYNCNTYWQAPCSLMLNLYYRSILTIIQDIALPISTVYESENPAQGYKPNEWLKLHYQTLWTNFKSFFIDKGVITGTEMKVVHAEQFSDFFDVDAATNNMYSPVKVQVRLARAQVLALKNIKVKNRILFSGTSMSEHYQNAFLKTANRRDNYILAGPYVKFLNSFHRQLFPNLKISCLYLWSNFCKKKQIPCVPGVSAEALNKFFSYINNNSKQFEEVNMLDVVPDSYVTYAKQRLNNAILRACGQTQFYAVTIHSIFPKVQETCALEYPHVLGTSSVDSVEDYVNNVQNLKALTVNSSLRESAANLARSRPIVTLPVVVNKYTGIAGNAQLFQSANLGYFMGRGVDKNLLGDSLFVKKQQNSYMRKKYLFMTPLVGNLLKPSYTHQGTAFEIETVKRTIQSILEDQADEDVLNRVVCELVKSLGAGCADLTLDDIQFYLGSYGMFSENILEKLDQLRELVGPWTHEWAESVLKSGTCETDEVQFVAFEEEQVKLTSMDHSGKVVGGKKRKIATMFDDLDL

DBP

DNA-binding protein

529 amino acids

Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its release from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.

Belongs to the adenoviridae E2A DNA-binding protein family.

59.086 kDa

MASREEEQRETTPERGRGAARRPPTMEDVSSPSPSPPPPRAPPKKRLRRRLESEDEEDSSQDALVPRTPSPRPSTSTADLAIASKKKKKRPSPKPERPPSPEVIVDSEEEREDVALQMVGFSNPPVLIKHGKGGKRTVRRLNEDDPVARGMRTQEEKEESSEAESESTVINPLSLPIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSNKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQSSKAKIVKNRWGRNVVQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISDKSVLASVHHPALIVFQCCNPVYRNSRAQGGGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF

DBP

DNA-binding protein

529 amino acids

Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.

Belongs to the adenoviridae E2A DNA-binding protein family.

59.139 kDa

MASREEEQRETTPERGRGAARRPPTMEDVSSPSPSPPPPRAPPKKRMRRRIESEDEEDSSQDALVPRTPSPRPSTSAADLAIAPKKKKKRPSPKPERPPSPEVIVDSEEEREDVALQMVGFSNPPVLIKHGKGGKRTVRRLNEDDPVARGMRTQEEEEEPSEAESEITVMNPLSVPIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSKKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQSSKAKIVKNRWGRNVVQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISDKSVLASVHHPALIVFQCCNPVYRNSRAQGGGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF

DBP

DNA-binding protein

517 amino acids

Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.

Belongs to the adenoviridae E2A DNA-binding protein family.

58.306 kDa

MASRGGNQSSDRQREHTPERGMGSASHPPPRPDRSPSQSPPPLPPKRNTYRRVGSNSSIESQVVLVSETSRSSLSPERSNSPPPIPPKKKPRKTKHVPLQDISQDSEEEREQVQLVRVGFSYPPVRIIEKDGKRSVEKIDNNDPISKGATSIAVRNPLSLPLVSAWEKGMEVMAVLMERYRLDNDLRTSFKLMPEQHEQYKRICHQYVNEEHRGIPLTFSSMKTLTAMMGRFMQGLVHSYSEIAHNNWECTGCALWAHGCTDYEGKVKCLHGTIMIQKDHIIEMDVASENGQRAMKENPDRAKITQNRWGRNVVQLANNDARCCVNDANCATNQFSSKSCGMFYTEGIKAQEAFKQYEAFMKAVYPGITPDQARMMLIPIHCDCNHKPGCAPVMGRQTCKMTPFGMANAEDLDVATISDPTVLASVRHPALMVFQCCNPVYRNSRVQNAGPNCDFKISAPDLLGALQLTRKLWQDTFPEIPVPKLVIPEFKWQNRLQFRNVSLPAGHYDSRQNPFDF

DBP

DNA-binding protein

512 amino acids

Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.

Belongs to the adenoviridae E2A DNA-binding protein family.

57.367 kDa

MAGRGGSQLERRRERTPDRGRGSASHPPGRESPSPPPLPLKRHTYRRVVSDQEEEIVVVSENSRSPSPQEQPPPPQQPPKKKPRKTKHVPLQDVSQDSEDEREAEEELGAVGFSYPPVRITGKDGKRSFETLNENDPLTKAASAKMAVTNPLSLPIVSAWEKGMEIMNMLMERYRVESDLKSNFQLMPEQGEVYRRICHLYINEEHRGIPLTFTSNKTLTTMMGRFLQGFVHAHSQIAHKNWESTGCALWLHGCTEVEGKLRCLHGTTMIQKEHMIEMDVASENGQRALKENPDRAKVTQNRWGRSVVQLANNDARCCVHDAGCATNQFSSKSCGVFFTEGAKAQQAFKQLEAFMKAMYPGMNADQAQVMLIPLHCDCNHKPGCVPTMGRQTCKMTPFGMANAEDLDVDGITDATVLASVKHPALMVFQCCNPVYRNSRAQNAGPNCDFKISAPDLLGALQLTRKLWTDSFPDTLLPKLLIPEFKWLAKYQFRNVSLPAGHAETSRQNPFDF

DBP

DNA-binding protein

484 amino acids

Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.

Belongs to the adenoviridae E2A DNA-binding protein family.

54.999 kDa

MASNQHSQRERTPDRSAQPPPPKMGRYFLDSESEEELEAVPLPPKKKVKKSMAAIPLSPESAEEEEAEPPRAVLGVMGFSMPPVRIMHHADGSQSFQKMETRQVHVLKASAQNSDENEKNVVVVRNPASQPLVSAWEKGMEAMAMLMEKYHVDHDERATFRFLPDQGSVYKKICTTWLNEEKRGLQLTFSSQKTFQELMGRFLQGYMQAYAGVQQNSWEPTGCCVWEHKCTEREGELRCLHGMEMVRKEHLVEMDVTSESGQRALKENPSKAKVAQNRWGRNVVQIKNDDARCCFHDVGCGNNSFSGKSCGLFYSEGMKAQIAFRQIEAFMLADYPHMRHGQKRLLMPVRCECLNKQDGLPRMGRQLCKITPFNLSNVDNIDINEVTDPGALASIKYPCLLVFQCANPVYRNARGNAGPNCDFKISAPDVMGALQLVRQLWGENFDGSPPRLVIPEFKWHQRLQYRNISLPTNHGDCREEPFDF

DBP

DNA-binding protein

474 amino acids

Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.

Belongs to the adenoviridae E2A DNA-binding protein family.

53.658 kDa

MAGRQREHPTVTPYLQETSPERPPPLPPKKKLRKNLQVPEQVHAPALSPEVVPDSEEDEEVLYHGFSYPGVEVVQKGNGKRQIRRLEKTVIPRDLTPPEEEENNQSGSSKAVTMLITNPQVDPLVSAWEKGMELMNVLMEKYHVENDEKTAFKFLPEQNAVYRKICQTWLNEERRGLSLTFTTQKTFTELMGRFLAAYVETYAGVKHHNWDTTGCAVWAHGCTREEGVLRCFHGREMIQKEQVVEVDVGSENGQRALKEQPSKTKVVQNRWGRSVVQIKNDDARCCAEDVSCGNNMFSSKSCGLFFSEGLKAQIAFKQMQAFLQAEYPQMQRGQQRILVPLRCECLNKKDLVPQLGRQMCKVTPFALSGAEDLKTSEVTDKSALASILHPCVLVFQCANPVYRNSRGSAGPNCDFKISAPDVISALQLVRQFWKENVEDPLPKLIIPEFKWSTRLQYRNVALPTGHGDAEVEPF

DBP

DNA-binding protein

473 amino acids

Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.

Belongs to the adenoviridae E2A DNA-binding protein family.

53.335 kDa

MAGRQQELPTITPYLQETSPERAPSLPPKKKLRKNVQVPDRVPVLPPSPEVVPDSEEEEEEVVYTGFSHPGVQVVQKASGKRYVRRLEPKGVPPPSEENNEEEEPSTSKAVTSVVLNPQAEPLVSAWEKGMDLMIKLMEKYHVEAEEKNGFKFLPEQSNVYRKICQTWLNEEHRGLPLTFTSHKTFVEMMGRFLRAYVESYAGVKNNEWEPTGCAIWLHGCTEQEGVLRCYHGLEMIQKEQLVEMDVASENAQRALKEHPSRAKVVQNRWGRSVVQLKNDDARCCVEDVSCATNVFSAKSCGLFFSEGTKAQTAFLQIEAFMQAEYPKMQNGLKRLLMVMRCDCLYKPTGVPQLGRQMCKATPFALSNVDSLRAEEVTDKVALASIQYPCVLVYQCANPVYRNSRGGQGPNCDFKISAPDLLGALQLVRRLWGENVDGPLPKMLIPEFKWSSRLQYRNVALPASHGDGEKEPF

DBP

DNA-binding protein

454 amino acids

Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.

Belongs to the adenoviridae E2A DNA-binding protein family.

50.295 kDa

MSHKKVVAISESSSDEEVPVAPPTAPPKKRQRKAVEEPRGHQAMVEIARQATAALKARGDPGSIIVQTFCDQTVDVDKEGNVIFTPAKQKSICNKSGSPLASVASKIFKASEHKWQSAMEFALKVLNAYQVDHSKLTLLPDEGTLECFKKAVQAYITTSKMHVTYTFTNQKTFLHVAGRLLLDFVIKAAELAPGVNPSGCVVWQHGCQSSLMCLHGSPMIQKEQLVEMDVNSENAQRALKENPEKTKIVSNRWGRNVVQFKNEDAFCCSMDVNMSGGNFSGASCGMFYTDGPKAIMAFQQIMAFLKACYPSMPNAESHLLMPLKCECNWNSSLPLLGRQTCKITPFSLASASHIDKSEVDDQKMLATLNNPAMLVFQCCNPVYRNSKAAPQKNCDFKISSVDLVSCLQIAKQIWLSTVGERPPVKFPEFHWSDEHRYQTTILPQGQHDDDLVLF

DBP

DNA-binding protein

454 amino acids

Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.

Belongs to the adenoviridae E2A DNA-binding protein family.

50.294 kDa

MSHKKVVAISESSSDEEVPVAPPTAPPKKRQRKAVEEPRGHQAMVEIARQATAALKARGDPGSIIVQTFCDQTVDVDKEGNVIFTPAKQKSICNKSGSPLASVASKIFKASEHKWQSAMEFALKVLNAYQVDHSKLTLLPDEGTLECFKKAVQAYITTSKMHVTYTFTNQKTFLHVAGRLLLDFVIKAAELAPGVNPSGCVVWQHGCQSSLMCLHGSPMIQKEQLVEMDVNSENAQRALKENPEKTKIVSNRWGRNVVQFKNEDAFCCSMDVNMSGGNFSGASCGMFYTDGPKAIMAFQQIMAFLKACYPSMPNAESHLLMPLKCECNWNSSLPLLGRQTCKITPFSLASANHIDKSEVDDQKMLATLNNPAMLVFQCCNPVYRNSKAAPQKNCDFKISSVDLVSCLQIAKQIWLSTVGEKPPVKFPEFHWSDEHRYQTTILPQGQHDDDLVLF

DBP

DNA-binding protein

441 amino acids

Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.

Belongs to the adenoviridae E2A DNA-binding protein family.

49.332 kDa

MERTPKRAHGFRSTKPVKRTAEVMMEEEEEEVEVVAPGRGATRKKVSRREESPSPVRRVTRRRETVVDDEENASDEESPEAPLSDPVVYGAQRAMATVASICEALDLQWQGASVRPDDSIWTKMGGTYVRKKHPEFRLTFSSYDSFNAQVGRFLAAVIYSRAGLEPKFVPGGAHVWRHGWFPALQEPFPKCMHGVDMVTKPRTVELNPSSEAGKRALAEQNGVIEKNRFGRQVVVLRFDANAVCYKDQEHSGFPHPHAHGSCAMVFSDAAKAVSAMRHDIDWTKALYPNADKRRAEECVLISTNCNCNYASDRAISGRQFCKMTPYKLNGTDDITRDMVESRPDMKAHKKNPHTMVFTCCNPQAASGGAGRGLKKTEKTCAWRLSAMDLRYAYVFATELFTAVMGSSEPTHVPEFRWNESYAFKTEVLAPVSPIASDDPFA

DBP

DNA-binding protein

397 amino acids

Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.

Belongs to the adenoviridae E2A DNA-binding protein family.

43.934 kDa

MSLSKTKNPALLAGPGDEAKEKVQAALELLHKFGSAFKVDTAGFSFHPESPECDKIFGAYLKNVKHVPTYSSAKTLTSVGGRILYAATCQYVKLTPVTNLTGCTLWEHGWGQNLKCYHGEGMCRKKNEIEMAATSESGVAALKEGRGAVEINRWGRQVVKITQENYVICMEDLQSRFNQPSANSCGLSFSDSDKARSAMENATELTRSIFSQAKMDHLLFMPICCYCNYGGKMILGRQLCKLTPFSISGTEGLREEDVSPVQAVSVRHPAVFVFQCCNATGGSKGKTSCDFKISHADLLQVLNLVRKMWLEVMGYPMPIHFPRFKWSPSLRVKNALLPEGSVNEDENPFGLDNSEDEEEVVPPSPPSPARKRTRTTVAEVHHKKKKKIVLESSEEDE

DBP

D site-binding protein

325 amino acids

This transcriptional activator recognizes and binds to the sequence 5'-RTTAYGTAAY-3' found in the promoter of genes such as albumin, CYP2A4 and CYP2A5. It is not essential for circadian rhythm generation, but modulates important clock output genes. May be a direct target for regulation by the circadian pacemaker component clock. May affect circadian period and sleep regulation (By similarity).

Belongs to the bZIP family. PAR subfamily.

34.322 kDa

MARPVSERTPAPLLLGGPTGAPPGGGALLGLRSLLQGTSKPKEPTSCLLKEKERKASPPAATVPGPGLETAGPADASAGAVVGGGSPRGRPGAAPGPGLLAPLLWERTLPFGDVEYVDLDAFLLEHGLPPSPPPPGGPSPAPSPVRTPAPSPRPGSCGSASPRSSPGHAPARAALGAAGGHRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL

DBP

D site-binding protein

325 amino acids

This transcriptional activator recognizes and binds to the sequence 5'-RTTAYGTAAY-3' found in the promoter of genes such as albumin, CYP2A4 and CYP2A5. It is not essential for circadian rhythm generation, but modulates important clock output genes. May be a direct target for regulation by the circadian pacemaker component clock. May affect circadian period and sleep regulation.

Belongs to the bZIP family. PAR subfamily.

34.349 kDa

MARPVSDRTPAPLLLGGPAGTPPGGGALLGLRSLLQGTSKPKEPASCLLKEKERKAALPAATTPGPGLETAGPADAPAGAVVGGGSPRGRPGPVPAPGLLAPLLWERTLPFGDVEYVDLDAFLLEHGLPPSPPPPGGPSPEPSPARTPAPSPGPGSCGSASPRSSPGHAPARAALGTASGHRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL

Dbp

D site-binding protein

325 amino acids

This transcriptional activator recognizes and binds to the sequence 5'-RTTAYGTAAY-3' found in the promoter of genes such as albumin, CYP2A4 and CYP2A5. It is not essential for circadian rhythm generation, but modulates important clock output genes. May be a direct target for regulation by the circadian pacemaker component clock. May affect circadian period and sleep regulation (By similarity).

Belongs to the bZIP family. PAR subfamily.

34.38 kDa

MARPLSDRTPGPLLLGGPAGAPPGGGALLGLRSLLQGNSKPKEPASCLLKEKERKATLPSAPVPGPGLETAGPADAPSGAVSGGGSPRGRSGPVAGPSLFAPLLWERTLPFGDVEYVDLDAFLLEHGLPPSPPPPGGLSPAPSPARTPAPSPGPGSCSSSSPRSSPGHAPARATLGAAGGHRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKVQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGTL

Dbp

D site-binding protein

325 amino acids

This transcriptional activator recognizes and binds to the sequence 5'-RTTAYGTAAY-3' found in the promoter of genes such as albumin, CYP2A4 and CYP2A5. It is not essential for circadian rhythm generation, but modulates important clock output genes. May be a direct target for regulation by the circadian pacemaker component clock. May affect circadian period and sleep regulation (By similarity).

Belongs to the bZIP family. PAR subfamily.

34.436 kDa

MARPLSDRTPGPLLLGGPAGAPPGGGALLGLRSLLQGNSKPKEPASCLLKEKERKATLPSAPVPGPVLETAGPADAPTGAVSGGGSPRGRSGPVAGPSLFAPLLWERTLPFGDVEYVDLDAFLLEHGLPPSPPPPGGLSPAPSPARTPAPSPGPGSCSSSSPRSSPGHAPARATLGAAGGHRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKVQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGTL

DBP

Remorin

190 amino acids

Exhibits a non sequence-specific DNA-binding activity.

Belongs to the remorin family.

20.968 kDa

MAEEQKTSKVDVESPAVLAPAKEPTPAPVEVADEKIHNPPPVESKALAVVEKPIEEHTPKKASSGSADRDVILADLEKEKKTSFIKAWEESEKSKAENRAQKKISDVHAWENSKKAAVEAQLRKIEEKLEKKKAQYGEKMKNKVAAIHKLAEEKRAMVEAKKGEELLKAEEMGAKYRATGVVPKATCGCF