DAD4

DASH complex subunit DAD4

76 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore (By similarity).

Belongs to the DASH complex DAD4 family.

8.667 kDa

MENPHEKDQSDALARIISGVSKLNSSIARVNEIQEEVYSRNLNLSVVSEIMQNYQASVDYYLRESGAMKEPFKNDD

DAD4

DASH complex subunit DAD4

73 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore (By similarity).

Belongs to the DASH complex DAD4 family.

8.467 kDa

MVENPYEEVQVNVLSRIIANVEKLNQSVRTLNQELENVNKRNKNLEVMGQICENYHRSVQFNLEATGNKKPPL

DAD4

DASH complex subunit DAD4

72 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore (By similarity).

Belongs to the DASH complex DAD4 family.

8.16 kDa

MENPHEKVQVGILARIVGNVERLNQSVATLNQELERINTRNRNLELMGQMCEHYGRATAFNLKTTGNRQGPV

DAD4

DASH complex subunit DAD4

72 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore (By similarity).

Belongs to the DASH complex DAD4 family.

8.452 kDa

MENPYEKVQSNILARIIGNVERLNQSVVILNQELRRVNTKNKNLELMSQMCENYRESVDFQLQATSKKQDPL

dad4

DASH complex subunit dad4

72 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore. May be necessary for growth under high osmotic stress.

Belongs to the DASH complex DAD4 family.

8.351 kDa

MNNPMEEQQSALLGRIISNVEKLNESITRLNHSLQLINMSNMNVELASQMWANYARNVKFHLEETHTLKDPI

DAD4

DASH complex subunit DAD4

72 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore. The DASH ring complex may both stabilize microtubules during chromosome attachment in anaphase A, and allow the chromosome to remain attached to the depolymerizing microtubule in anaphase B. Microtubule depolymerization proceeds by protofilament splaying and induces the kinetochore-attached ring to slide longitudinally, thereby helping to transduce depolymerization energy into pulling forces to disjoin chromatids.

Belongs to the DASH complex DAD4 family.

8.155 kDa

MENPHEQVQANILSRIIGNVKRLNESVAILNQELVTINNRNKNLEIMGAICDNYHSSVQFNLEATNNKKPPL